General information for g15915.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Elongation of very long chain fatty acids protein 4.
Parent gene
- The parent gene g15915 is located on chr_4: 7400249..7401044 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15915 | g15915.t1 | isoform | g15915.t1 | 7400249 | 7401044 |
| chr_4 | g15915 | g15915.t1 | exon | g15915.t1.exon1 | 7400249 | 7400293 |
| chr_4 | g15915 | g15915.t1 | cds | g15915.t1.CDS1 | 7400249 | 7400293 |
| chr_4 | g15915 | g15915.t1 | exon | g15915.t1.exon2 | 7400485 | 7400656 |
| chr_4 | g15915 | g15915.t1 | cds | g15915.t1.CDS2 | 7400485 | 7400656 |
| chr_4 | g15915 | g15915.t1 | exon | g15915.t1.exon3 | 7400723 | 7400850 |
| chr_4 | g15915 | g15915.t1 | cds | g15915.t1.CDS3 | 7400723 | 7400850 |
| chr_4 | g15915 | g15915.t1 | exon | g15915.t1.exon4 | 7400922 | 7401044 |
| chr_4 | g15915 | g15915.t1 | cds | g15915.t1.CDS4 | 7400922 | 7401044 |
| chr_4 | g15915 | g15915.t1 | TSS | g15915.t1 | NA | NA |
| chr_4 | g15915 | g15915.t1 | TTS | g15915.t1 | NA | NA |
Sequences
>g15915.t1 Gene=g15915 Length=468
ATGTGTGAAATTCCTCAACAAATTTTTACACCTGATGAAATTAAAATAGTCAATGCAGTG
TGGTGGCATTATTTTTCAAAATTTCTTGAATTTTGTGATACATTTTTCATTGTTTTTCGA
AAAAAAACTAAAAGTTTGTCATTTCTACACGTTTATCATCATTCAAGTGTATTTGCTTTT
TGGTGGTTTTTTATCAAGTTTTATCCTAGTGGATTCGTTGCATTAATTGCAATGACAAAT
TCATTTGTTCATATTTTTATGTACATTTATTATGGATTAGCTTCAATTGGACCATCAATG
AATAAATATCTTTGGTGGAAAAAATATTTGACAATTTTACAAATTCGCATTTTTGGAACA
ACAATGCCGCTTATACATTCACTTTGGCTGGCTGGCTGGCTGGCTGGCTGGCTGGCTGGC
TGGCTGGCTGGCTGGCTGGCTGCTGTTCGGCTCCCGGGTGTCCTCTGA
>g15915.t1 Gene=g15915 Length=155
MCEIPQQIFTPDEIKIVNAVWWHYFSKFLEFCDTFFIVFRKKTKSLSFLHVYHHSSVFAF
WWFFIKFYPSGFVALIAMTNSFVHIFMYIYYGLASIGPSMNKYLWWKKYLTILQIRIFGT
TMPLIHSLWLAGWLAGWLAGWLAGWLAAVRLPGVL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g15915.t1 | PANTHER | PTHR11157 | FATTY ACID ACYL TRANSFERASE-RELATED | 9 | 122 | 2.3E-40 |
| 3 | g15915.t1 | PANTHER | PTHR11157:SF12 | ELONGATION OF VERY LONG CHAIN FATTY ACIDS PROTEIN 4 | 9 | 122 | 2.3E-40 |
| 1 | g15915.t1 | Pfam | PF01151 | GNS1/SUR4 family | 15 | 126 | 3.2E-34 |
| 11 | g15915.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 19 | - |
| 17 | g15915.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 39 | - |
| 10 | g15915.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 40 | 45 | - |
| 18 | g15915.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 46 | 65 | - |
| 13 | g15915.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 66 | 70 | - |
| 16 | g15915.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 71 | 93 | - |
| 9 | g15915.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 94 | 104 | - |
| 14 | g15915.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 105 | 125 | - |
| 12 | g15915.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 126 | 130 | - |
| 15 | g15915.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 131 | 149 | - |
| 8 | g15915.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 150 | 155 | - |
| 7 | g15915.t1 | ProSitePatterns | PS01188 | ELO family signature. | 46 | 54 | - |
| 6 | g15915.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 57 | 79 | - |
| 5 | g15915.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 84 | 106 | - |
| 4 | g15915.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 127 | 149 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
