General information for g16094.t25
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g16094 is located on chr_4: 8135015..8141389 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16094 | g16094.t25 | isoform | g16094.t25 | 8135015 | 8135379 |
| chr_4 | g16094 | g16094.t25 | exon | g16094.t25.exon1 | 8135015 | 8135092 |
| chr_4 | g16094 | g16094.t25 | cds | g16094.t25.CDS1 | 8135016 | 8135092 |
| chr_4 | g16094 | g16094.t25 | exon | g16094.t25.exon2 | 8135147 | 8135379 |
| chr_4 | g16094 | g16094.t25 | cds | g16094.t25.CDS2 | 8135147 | 8135372 |
| chr_4 | g16094 | g16094.t25 | TTS | g16094.t25 | 8135519 | 8135519 |
| chr_4 | g16094 | g16094.t25 | TSS | g16094.t25 | NA | NA |
Sequences
>g16094.t25 Gene=g16094 Length=311
GTACTCATTTGATACATTTTCGCATAAAAAATCTTGCTTGGTAAAGAAAATTGACACAAT
CAGTGAGAAACTGTCAAATGCACGCTATCCACCATATAGTGACAAAAAGATCAACTATTT
GACTTTTCTTACTAAAAAACGTAAAGGCTTTTCAATTCCTTACTTACCACAGTTAGTTTT
GCTTGGAGTTGGTGTTGCTGCAACGATTTTCGTTCAACGCATTTTGCCTGAAGTATTAAA
GAATAAGAAATTTGAAATATTTAGTATTGCATTAACAGCTATATTCAAACTTTTTACAGT
GTGAACAGTAG
>g16094.t25 Gene=g16094 Length=100
YSFDTFSHKKSCLVKKIDTISEKLSNARYPPYSDKKINYLTFLTKKRKGFSIPYLPQLVL
LGVGVAATIFVQRILPEVLKNKKFEIFSIALTAIFKLFTV
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g16094.t25 | Gene3D | G3DSA:3.40.605.10 | Aldehyde Dehydrogenase; Chain A | 1 | 49 | 1.0E-6 |
| 1 | g16094.t25 | PANTHER | PTHR43570:SF29 | ALDEHYDE DEHYDROGENASE TYPE III, ISOFORM Q | 1 | 75 | 1.8E-18 |
| 2 | g16094.t25 | PANTHER | PTHR43570 | ALDEHYDE DEHYDROGENASE | 1 | 75 | 1.8E-18 |
| 6 | g16094.t25 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 53 | - |
| 7 | g16094.t25 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 54 | 75 | - |
| 5 | g16094.t25 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 76 | 100 | - |
| 3 | g16094.t25 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 49 | 71 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016491 | oxidoreductase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
