General information for g16098.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Alkaline ceramidase.
Parent gene
- The parent gene g16098 is located on chr_4: 8145061..8146084 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16098 | g16098.t1 | TTS | g16098.t1 | 8144689 | 8144689 |
| chr_4 | g16098 | g16098.t1 | isoform | g16098.t1 | 8144718 | 8146084 |
| chr_4 | g16098 | g16098.t1 | exon | g16098.t1.exon1 | 8144718 | 8144990 |
| chr_4 | g16098 | g16098.t1 | cds | g16098.t1.CDS1 | 8144718 | 8144990 |
| chr_4 | g16098 | g16098.t1 | exon | g16098.t1.exon2 | 8145049 | 8145304 |
| chr_4 | g16098 | g16098.t1 | cds | g16098.t1.CDS2 | 8145049 | 8145304 |
| chr_4 | g16098 | g16098.t1 | exon | g16098.t1.exon3 | 8145360 | 8145550 |
| chr_4 | g16098 | g16098.t1 | cds | g16098.t1.CDS3 | 8145360 | 8145550 |
| chr_4 | g16098 | g16098.t1 | exon | g16098.t1.exon4 | 8145900 | 8145955 |
| chr_4 | g16098 | g16098.t1 | cds | g16098.t1.CDS4 | 8145900 | 8145955 |
| chr_4 | g16098 | g16098.t1 | exon | g16098.t1.exon5 | 8146027 | 8146084 |
| chr_4 | g16098 | g16098.t1 | cds | g16098.t1.CDS5 | 8146027 | 8146084 |
| chr_4 | g16098 | g16098.t1 | TSS | g16098.t1 | 8146097 | 8146097 |
Sequences
>g16098.t1 Gene=g16098 Length=834
ATGTTTATCGATAAAGAAGCAATTTATAAATCATTAGAATGGCATAGCAGTCCTGTTGAC
TGGTGTGAGCCAAATTATCAAATACTTTCTTATGTAGCCGAATTTTATAATACTTTTAGC
TGTCTCATCATGGTTTTTGTGCCACCCATAGCAATTTATTTATTTAGAAATTATGCAAAA
GCTGTCAATTGTGGTATACAAGCTATAATGTTTATGCTGATTGTGGTTGGAGTGACATCA
ATGTATTTTCATGGAACACTTTCATTAATGGGACAATTACTTGATGAACTATCAATATTA
TGGGTTTATGCCCTTGGAGTTTGTCTCTATTGTCCATCAAAATATATTCCAAAGTCAATG
TGTAGAAAAAAATTTTCAGTTGTAATCACGGCAATTGCTTTGATGTTCACAGTCTTATCA
GTTTGGAAGCCTTTTGTCAATGCTTTTGCTCAAATGTCACTAACAATACCGATTATCTAT
TATGTATCAACAGAGATTAAGAATCTCAAAAGAAATGAAAAAGAAGTGTACAAAATTGGT
GTAAAAACACTTGTCATGGGTATCACTGCAGTTATTCTTTGGTTCAATGATAGACTTTTT
TGTGAATTTTACAAATCGTATGGAATAATTTATTTGCATGCTATTTGGCATATTCTCAGT
TTCACTGCTTCATATTATGCTTCATGTCTTACTGCATACTTTTTTGTTAAATTAGAAAAA
CCATCAATTACATGTGAAATTGCTTACTGGCCAAATAATTGCAATTTTAAAATGTTTTGT
ATTCCATACGTTGAAATTATAAGTGATAAAAAAGTTAAGAAAAAGAAAAATTAA
>g16098.t1 Gene=g16098 Length=277
MFIDKEAIYKSLEWHSSPVDWCEPNYQILSYVAEFYNTFSCLIMVFVPPIAIYLFRNYAK
AVNCGIQAIMFMLIVVGVTSMYFHGTLSLMGQLLDELSILWVYALGVCLYCPSKYIPKSM
CRKKFSVVITAIALMFTVLSVWKPFVNAFAQMSLTIPIIYYVSTEIKNLKRNEKEVYKIG
VKTLVMGITAVILWFNDRLFCEFYKSYGIIYLHAIWHILSFTASYYASCLTAYFFVKLEK
PSITCEIAYWPNNCNFKMFCIPYVEIISDKKVKKKKN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g16098.t1 | PANTHER | PTHR46139 | ALKALINE CERAMIDASE | 8 | 271 | 1.3E-81 |
| 1 | g16098.t1 | Pfam | PF05875 | Ceramidase | 15 | 259 | 6.0E-49 |
| 15 | g16098.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 34 | - |
| 20 | g16098.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 35 | 55 | - |
| 13 | g16098.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 56 | 61 | - |
| 19 | g16098.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 62 | 85 | - |
| 17 | g16098.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 86 | 96 | - |
| 24 | g16098.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 97 | 113 | - |
| 10 | g16098.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 114 | 124 | - |
| 23 | g16098.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 125 | 142 | - |
| 14 | g16098.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 143 | 147 | - |
| 21 | g16098.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 148 | 164 | - |
| 12 | g16098.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 165 | 175 | - |
| 22 | g16098.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 176 | 195 | - |
| 16 | g16098.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 196 | 214 | - |
| 18 | g16098.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 215 | 236 | - |
| 11 | g16098.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 237 | 277 | - |
| 9 | g16098.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 33 | 55 | - |
| 8 | g16098.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 62 | 84 | - |
| 5 | g16098.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 99 | 116 | - |
| 7 | g16098.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 125 | 142 | - |
| 6 | g16098.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 146 | 163 | - |
| 4 | g16098.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 176 | 194 | - |
| 3 | g16098.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 214 | 236 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016811 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides | MF |
| GO:0016021 | integral component of membrane | CC |
| GO:0006672 | ceramide metabolic process | BP |
KEGG
Orthology
- This transcript has been annotated with K04711 (dihydroceramidase [EC:3.5.1.-])
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed