| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16221 | g16221.t2 | TSS | g16221.t2 | 8641662 | 8641662 |
| chr_4 | g16221 | g16221.t2 | isoform | g16221.t2 | 8641829 | 8646265 |
| chr_4 | g16221 | g16221.t2 | exon | g16221.t2.exon1 | 8641829 | 8642071 |
| chr_4 | g16221 | g16221.t2 | cds | g16221.t2.CDS1 | 8641829 | 8642071 |
| chr_4 | g16221 | g16221.t2 | exon | g16221.t2.exon2 | 8645046 | 8645361 |
| chr_4 | g16221 | g16221.t2 | cds | g16221.t2.CDS2 | 8645046 | 8645361 |
| chr_4 | g16221 | g16221.t2 | exon | g16221.t2.exon3 | 8645431 | 8645586 |
| chr_4 | g16221 | g16221.t2 | cds | g16221.t2.CDS3 | 8645431 | 8645586 |
| chr_4 | g16221 | g16221.t2 | exon | g16221.t2.exon4 | 8645652 | 8645837 |
| chr_4 | g16221 | g16221.t2 | cds | g16221.t2.CDS4 | 8645652 | 8645837 |
| chr_4 | g16221 | g16221.t2 | exon | g16221.t2.exon5 | 8645897 | 8645941 |
| chr_4 | g16221 | g16221.t2 | cds | g16221.t2.CDS5 | 8645897 | 8645941 |
| chr_4 | g16221 | g16221.t2 | exon | g16221.t2.exon6 | 8646083 | 8646265 |
| chr_4 | g16221 | g16221.t2 | cds | g16221.t2.CDS6 | 8646083 | 8646126 |
| chr_4 | g16221 | g16221.t2 | TTS | g16221.t2 | 8646693 | 8646693 |
>g16221.t2 Gene=g16221 Length=1129
ATGGGCGATGATATTTTTATAAAACGTGTAGATTTTGAAGTAAATAATAACGAACCAAAT
ACAGTAATTCCAAATGGTCATGAAATGTTGACAGATGATGTAGAAAATTTGAATAAACCT
GGACCACCACCAACATGTTGTGGCAAATTTTTATATTATCTTGATAAATTTGGGATCAAA
GCAGCACTAAGTCATGTTGGGTTGCTTTTAGGATTAGCTCTTTATTGTTATGCAGGCGGA
TGGGTGTTTGTCCAACTAGAACATCCTCCAATGAAAGAAAATGAATATGAACTAAGAAAT
AACATTTCGATCAGCCGTTCTGAATTTATTCAAATAATTATTGATGCACACAATGATAAT
GATTTAAATGAGAATTTTATATCAGAAAAATTACAAGAATATGAAATGGTAGCACAAGCG
GCAGTTGAAGGAAATTTGCAGCTTACAAATACAGCTGGGAATATTACAAATACAAATGAT
ATTGCATTTCCAGTGCAATCTGAAAAATGGACATTAATGCAAGCAATCTTTTTTGCATCA
ACAATTTGCACAACAATTGGTTATGGAAATATTGCACCAGAAACTTTCGAAGGACGATTA
TTTTGCATCATCTTTGCTATTTTTGGGCTCCCATTTACGCTCACTGTAATTGCTGATTAT
GGTAGCTTATTTGCTAATTCAGTATCAGCTGTAGCTAAAAAATGTAAAACATTCAAATTT
TGCTCAAAAGATTCAAAATTTAGAACATTCAAAGGTCGAAAGTGGTTATATGCTATTGGA
GCTGTAATTTTCTTAGGATTTTATTTATCAGCTGGTGCAGCAGTTTTTGAACAATGGGAG
CATTGGACATTTTTTGAAGGCTTTTATTTTAGTTTTATCACTATGACAACTATTGGTTTA
GGTGATCTTGTTCCAGGTGAAAAACCAATGTTAATTTGCACCGTAAGTCTACATTCTTAT
TGGATTAGCATTAACAAGTACAATTCTTGAACTCGTAAGACGGCAATATGTTCAAAGCTG
GCAAAAATTACAACAATTAAAACTTGGTTCTTTTGCTGACTCATTGCGACGTCTAGGTGA
ATCTCATGGTGCTATTGATGTCAATGATTTACGTTCAATTCTCTCAGTT
>g16221.t2 Gene=g16221 Length=329
MGDDIFIKRVDFEVNNNEPNTVIPNGHEMLTDDVENLNKPGPPPTCCGKFLYYLDKFGIK
AALSHVGLLLGLALYCYAGGWVFVQLEHPPMKENEYELRNNISISRSEFIQIIIDAHNDN
DLNENFISEKLQEYEMVAQAAVEGNLQLTNTAGNITNTNDIAFPVQSEKWTLMQAIFFAS
TICTTIGYGNIAPETFEGRLFCIIFAIFGLPFTLTVIADYGSLFANSVSAVAKKCKTFKF
CSKDSKFRTFKGRKWLYAIGAVIFLGFYLSAGAAVFEQWEHWTFFEGFYFSFITMTTIGL
GDLVPGEKPMLICTVSLHSYWISINKYNS
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 14 | g16221.t2 | Gene3D | G3DSA:1.10.287.70 | - | 61 | 326 | 1.2E-61 |
| 3 | g16221.t2 | PANTHER | PTHR11003 | POTASSIUM CHANNEL, SUBFAMILY K | 100 | 315 | 4.6E-53 |
| 4 | g16221.t2 | PANTHER | PTHR11003:SF142 | TWIK FAMILY OF POTASSIUM CHANNELS PROTEIN 7-LIKE PROTEIN | 100 | 315 | 4.6E-53 |
| 5 | g16221.t2 | PRINTS | PR01333 | Two pore domain K+ channel signature | 181 | 209 | 3.8E-16 |
| 6 | g16221.t2 | PRINTS | PR01333 | Two pore domain K+ channel signature | 296 | 305 | 3.8E-16 |
| 1 | g16221.t2 | Pfam | PF07885 | Ion channel | 167 | 224 | 8.8E-16 |
| 2 | g16221.t2 | Pfam | PF07885 | Ion channel | 264 | 315 | 4.2E-14 |
| 19 | g16221.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 61 | - |
| 24 | g16221.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 62 | 84 | - |
| 15 | g16221.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 85 | 171 | - |
| 23 | g16221.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 172 | 192 | - |
| 20 | g16221.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 193 | 197 | - |
| 21 | g16221.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 198 | 218 | - |
| 17 | g16221.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 219 | 254 | - |
| 22 | g16221.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 255 | 276 | - |
| 18 | g16221.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 277 | 281 | - |
| 25 | g16221.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 282 | 301 | - |
| 16 | g16221.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 302 | 329 | - |
| 13 | g16221.t2 | SUPERFAMILY | SSF81324 | Voltage-gated potassium channels | 62 | 230 | 2.75E-21 |
| 12 | g16221.t2 | SUPERFAMILY | SSF81324 | Voltage-gated potassium channels | 248 | 309 | 2.22E-15 |
| 9 | g16221.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 62 | 84 | - |
| 11 | g16221.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 170 | 192 | - |
| 7 | g16221.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 199 | 218 | - |
| 8 | g16221.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 255 | 277 | - |
| 10 | g16221.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 284 | 306 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016020 | membrane | CC |
| GO:0005267 | potassium channel activity | MF |
| GO:0071805 | potassium ion transmembrane transport | BP |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed