Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_4 g16254 g16254.t1 isoform g16254.t1 8862247 8862681
chr_4 g16254 g16254.t1 exon g16254.t1.exon1 8862247 8862415
chr_4 g16254 g16254.t1 cds g16254.t1.CDS1 8862247 8862415
chr_4 g16254 g16254.t1 exon g16254.t1.exon2 8862533 8862681
chr_4 g16254 g16254.t1 cds g16254.t1.CDS2 8862533 8862681
chr_4 g16254 g16254.t1 TSS g16254.t1 NA NA
chr_4 g16254 g16254.t1 TTS g16254.t1 NA NA

Sequences

>g16254.t1 Gene=g16254 Length=318
ATGTTGAAAATTGCTGCAACACAAAATATTACAAAAGTTGATCTGACTGTACTTGATAGT
AGTCAAGAAGATATAAGCATAATTTCAAGTGATGTTCCTATGACACCACAAACACCTTTG
ACTGTAAAAAGAACAGCACGACAGAAGCAAAACTTTCGAGAAGTTCAATTTACACCTTCC
CAAAGCTCACCGCTTCGTAAAAATCCTAAAAAATGCCAGTCTCTTACTAAATTGAATTTA
CAGTCATCTCCTGAAGTTACACCACAATCAACTTCTCGCTTATCGCAACAACTCGACACC
AAAATACAAGTCGAATGA

>g16254.t1 Gene=g16254 Length=105
MLKIAATQNITKVDLTVLDSSQEDISIISSDVPMTPQTPLTVKRTARQKQNFREVQFTPS
QSSPLRKNPKKCQSLTKLNLQSSPEVTPQSTSRLSQQLDTKIQVE

Protein features from InterProScan

Transcript Database ID Name Start End E.value
g16254.t1 MobiDBLite mobidb-lite consensus disorder prediction 46 105 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values