| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16280 | g16280.t5 | TTS | g16280.t5 | 8956500 | 8956500 |
| chr_4 | g16280 | g16280.t5 | isoform | g16280.t5 | 8956673 | 8957068 |
| chr_4 | g16280 | g16280.t5 | exon | g16280.t5.exon1 | 8956673 | 8956897 |
| chr_4 | g16280 | g16280.t5 | cds | g16280.t5.CDS1 | 8956673 | 8956897 |
| chr_4 | g16280 | g16280.t5 | exon | g16280.t5.exon2 | 8956961 | 8957068 |
| chr_4 | g16280 | g16280.t5 | cds | g16280.t5.CDS2 | 8956961 | 8957029 |
| chr_4 | g16280 | g16280.t5 | TSS | g16280.t5 | 8957532 | 8957532 |
>g16280.t5 Gene=g16280 Length=333
TTTCATATCCATGAATATGGTGACATTACCAACGGATGTATGTCTGCCGGACAGCATTTC
AATCCATACAACAAACAACATGGAGGAACTCTTGATGACAATCGTCATGTTGGTGATTTG
GGAAATATTAAAGCTGAAGAAAATGGAATTGCAAAAATTGACATAACAGATCGAATGATT
TCTCTGCATGGAAACTCGAATATTATTGGTCGCACGTTGGTTGTACATGTAAATGCCGAC
GATTTGGGACTTGGGTCCAATGAACAATCAAAATCCGACGGTAACTCTGGTGGAAGAATT
AGCTGTGGTGTTATTGGCATCTGCAAGGCATAA
>g16280.t5 Gene=g16280 Length=97
MSAGQHFNPYNKQHGGTLDDNRHVGDLGNIKAEENGIAKIDITDRMISLHGNSNIIGRTL
VVHVNADDLGLGSNEQSKSDGNSGGRISCGVIGICKA
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g16280.t5 | CDD | cd00305 | Cu-Zn_Superoxide_Dismutase | 1 | 89 | 1.40044E-33 |
| 8 | g16280.t5 | Gene3D | G3DSA:2.60.40.200 | - | 1 | 96 | 4.5E-36 |
| 11 | g16280.t5 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 22 | - |
| 12 | g16280.t5 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 15 | - |
| 2 | g16280.t5 | PANTHER | PTHR10003 | SUPEROXIDE DISMUTASE CU-ZN -RELATED | 2 | 97 | 9.9E-38 |
| 3 | g16280.t5 | PANTHER | PTHR10003:SF66 | SUPEROXIDE DISMUTASE [CU-ZN] | 2 | 97 | 9.9E-38 |
| 6 | g16280.t5 | PRINTS | PR00068 | Cu-Zn-superoxide dismutase family signature | 23 | 32 | 1.6E-26 |
| 4 | g16280.t5 | PRINTS | PR00068 | Cu-Zn-superoxide dismutase family signature | 42 | 64 | 1.6E-26 |
| 5 | g16280.t5 | PRINTS | PR00068 | Cu-Zn-superoxide dismutase family signature | 67 | 93 | 1.6E-26 |
| 1 | g16280.t5 | Pfam | PF00080 | Copper/zinc superoxide dismutase (SODC) | 2 | 92 | 2.7E-29 |
| 10 | g16280.t5 | ProSitePatterns | PS00332 | Copper/Zinc superoxide dismutase signature 2. | 81 | 92 | - |
| 7 | g16280.t5 | SUPERFAMILY | SSF49329 | Cu,Zn superoxide dismutase-like | 1 | 95 | 5.89E-34 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006801 | superoxide metabolic process | BP |
| GO:0004784 | superoxide dismutase activity | MF |
| GO:0046872 | metal ion binding | MF |
| GO:0055114 | NA | NA |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.