| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16289 | g16289.t23 | TTS | g16289.t23 | 8979680 | 8979680 |
| chr_4 | g16289 | g16289.t23 | isoform | g16289.t23 | 8979839 | 8980639 |
| chr_4 | g16289 | g16289.t23 | exon | g16289.t23.exon1 | 8979839 | 8980063 |
| chr_4 | g16289 | g16289.t23 | cds | g16289.t23.CDS1 | 8979839 | 8980063 |
| chr_4 | g16289 | g16289.t23 | exon | g16289.t23.exon2 | 8980149 | 8980232 |
| chr_4 | g16289 | g16289.t23 | cds | g16289.t23.CDS2 | 8980149 | 8980232 |
| chr_4 | g16289 | g16289.t23 | exon | g16289.t23.exon3 | 8980396 | 8980456 |
| chr_4 | g16289 | g16289.t23 | cds | g16289.t23.CDS3 | 8980396 | 8980456 |
| chr_4 | g16289 | g16289.t23 | exon | g16289.t23.exon4 | 8980577 | 8980639 |
| chr_4 | g16289 | g16289.t23 | cds | g16289.t23.CDS4 | 8980577 | 8980608 |
| chr_4 | g16289 | g16289.t23 | TSS | g16289.t23 | 8980729 | 8980729 |
>g16289.t23 Gene=g16289 Length=433
ATGGTAAAAGCAGTTTGTGTAATGATAGGTGATGTCGAAGGAACATGTTTCTTTGAGCAA
GTTGATGGAAAAGGCCCAGTTCATATTACCGGTGAGGTCAAAGGTCTTAAACCTGGATTA
CATGGTTTTCACGTCCATGAATATGGTGACAATACCAATGGCTGCATGTCAGCTGGTCAA
CATTTCAATCCAACTAATAAAGATCATGGTTGGTGATTTGGGAAATGTCGAAGCTGGAGC
TGATGGAACCGCTAAAATTGACATAACTGATAAAGTGATGTCTTTAAATGGAGAATTTAG
TATTATTGGTCGAACAATGGTTGTCCACACTAATCCAGATGATTTGGGTGTTGGTGGTGC
AGAAACATCAAAGAAAGACGGTAACGCTGGTGGCCGCCTGGCTTGCGGCGTTATTGGCAT
CTGCAAGGCATAA
>g16289.t23 Gene=g16289 Length=133
MSKEHVSLSKLMEKAQFILPVRSKVLNLDYMVFTSMNMVTIPMAACQLVNISIQLIKIMV
GDLGNVEAGADGTAKIDITDKVMSLNGEFSIIGRTMVVHTNPDDLGVGGAETSKKDGNAG
GRLACGVIGICKA
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g16289.t23 | Gene3D | G3DSA:2.60.40.200 | - | 47 | 133 | 5.9E-27 |
| 2 | g16289.t23 | PANTHER | PTHR10003 | SUPEROXIDE DISMUTASE CU-ZN -RELATED | 59 | 133 | 9.5E-28 |
| 3 | g16289.t23 | PANTHER | PTHR10003:SF66 | SUPEROXIDE DISMUTASE [CU-ZN] | 59 | 133 | 9.5E-28 |
| 6 | g16289.t23 | PRINTS | PR00068 | Cu-Zn-superoxide dismutase family signature | 59 | 68 | 1.8E-25 |
| 5 | g16289.t23 | PRINTS | PR00068 | Cu-Zn-superoxide dismutase family signature | 78 | 100 | 1.8E-25 |
| 4 | g16289.t23 | PRINTS | PR00068 | Cu-Zn-superoxide dismutase family signature | 103 | 129 | 1.8E-25 |
| 1 | g16289.t23 | Pfam | PF00080 | Copper/zinc superoxide dismutase (SODC) | 59 | 128 | 8.8E-21 |
| 11 | g16289.t23 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 29 | - |
| 12 | g16289.t23 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 30 | 49 | - |
| 10 | g16289.t23 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 50 | 133 | - |
| 8 | g16289.t23 | ProSitePatterns | PS00332 | Copper/Zinc superoxide dismutase signature 2. | 117 | 128 | - |
| 7 | g16289.t23 | SUPERFAMILY | SSF49329 | Cu,Zn superoxide dismutase-like | 59 | 131 | 1.7E-24 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006801 | superoxide metabolic process | BP |
| GO:0004784 | superoxide dismutase activity | MF |
| GO:0046872 | metal ion binding | MF |
| GO:0055114 | NA | NA |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed