General information for g1632.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Acyl-CoA Delta(11) desaturase.
Parent gene
- The parent gene g1632 is located on chr_3: 12235604..12236410 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1632 | g1632.t1 | TSS | g1632.t1 | 12234582 | 12234582 |
| chr_3 | g1632 | g1632.t1 | isoform | g1632.t1 | 12234912 | 12236410 |
| chr_3 | g1632 | g1632.t1 | exon | g1632.t1.exon1 | 12234912 | 12235071 |
| chr_3 | g1632 | g1632.t1 | cds | g1632.t1.CDS1 | 12234912 | 12235071 |
| chr_3 | g1632 | g1632.t1 | exon | g1632.t1.exon2 | 12235135 | 12235265 |
| chr_3 | g1632 | g1632.t1 | cds | g1632.t1.CDS2 | 12235135 | 12235265 |
| chr_3 | g1632 | g1632.t1 | exon | g1632.t1.exon3 | 12235338 | 12235543 |
| chr_3 | g1632 | g1632.t1 | cds | g1632.t1.CDS3 | 12235338 | 12235543 |
| chr_3 | g1632 | g1632.t1 | exon | g1632.t1.exon4 | 12235598 | 12235822 |
| chr_3 | g1632 | g1632.t1 | cds | g1632.t1.CDS4 | 12235598 | 12235822 |
| chr_3 | g1632 | g1632.t1 | exon | g1632.t1.exon5 | 12236134 | 12236410 |
| chr_3 | g1632 | g1632.t1 | cds | g1632.t1.CDS5 | 12236134 | 12236410 |
| chr_3 | g1632 | g1632.t1 | TTS | g1632.t1 | 12236500 | 12236500 |
Sequences
>g1632.t1 Gene=g1632 Length=999
ATGACAGAAACAACAACAGAAACTTCAAAACCAAGATCAGCTGATTACAAAAGAGAAGCA
TCATGGCCCAGTGTACTTTTCTTCATTCATTTGAATATTTTAGGACTTTATGGAATCGTC
ATTTTATTCACTCATACAAAATTGATCACAATTTTATTCTCATTTATTTTGACAATTATG
GGAATGTATGGAACGACAGTTGGTGCACACAGACTCTGGACTCATCAAACATTTAAAGCA
AATACTTCACTTAGATTTATTCTTATGCTATGTCAAACTATGGCTGGTCAGGGTTCAATT
TATGATTTTGTTCGAACTCATCGTTTGCATCATCAAACTTTTAAAACTGCTGATGATCCA
TTTTATAGTGACAAAGATTTTCTCTCAGCTCAAGTTTTTGCTCATATCAGAAAATTAAGT
ACTAGACAAGAAAAATTACTTGAAACTGTGAATATGAAAGATATTGAAGAAGATGGAATT
GTCATGTTCCAAAAAAGATTTTATTGGATTCTTTATTTGATTCTTTTTGTTCTGCTGCCA
ATCAATGCACCATTAGAATATTGGGATGATACTGTGCAAGCTGCAATCTTTGTTGCTTTT
TCATTGAGATATTTAATTGTCATCAATTTCGCTTGGCTCGTTAATTCAGCTCATTTCATT
TGGGCTTTGGATAAAAATCACAAACAATCTGACTCAAATATGGTCTTTATTGTCACTAAA
AGTTACTGGCCTCAATATCACTATTTAATTCCATACGACTATCAAACAGGAGAATTTGGC
AATTATGGAGAAGGAACATCAACAAGTTTAATTAGAATTTTTGCAGCAATGGGGTGGGCA
ACAGAGCTTAAAACAGTGACATCAGATGCAGTTAGAAAAGGACTCGCAATGGCTGTTGAT
ACTGGAAGAGAAATTGTTGATTGCATAAAAGAGGCAAATGATGAAGAATTGCTAAAATTG
CCACCTGATCATTATTTGAAAAGAGAAAATTTGAGTTAA
>g1632.t1 Gene=g1632 Length=332
MTETTTETSKPRSADYKREASWPSVLFFIHLNILGLYGIVILFTHTKLITILFSFILTIM
GMYGTTVGAHRLWTHQTFKANTSLRFILMLCQTMAGQGSIYDFVRTHRLHHQTFKTADDP
FYSDKDFLSAQVFAHIRKLSTRQEKLLETVNMKDIEEDGIVMFQKRFYWILYLILFVLLP
INAPLEYWDDTVQAAIFVAFSLRYLIVINFAWLVNSAHFIWALDKNHKQSDSNMVFIVTK
SYWPQYHYLIPYDYQTGEFGNYGEGTSTSLIRIFAAMGWATELKTVTSDAVRKGLAMAVD
TGREIVDCIKEANDEELLKLPPDHYLKRENLS
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 23 | g1632.t1 | CDD | cd03505 | Delta9-FADS-like | 47 | 284 | 1.03619E-43 |
| 1 | g1632.t1 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 4 | 320 | 5.4E-158 |
| 2 | g1632.t1 | PANTHER | PTHR11351:SF26 | AGAP003050-PA | 4 | 320 | 5.4E-158 |
| 4 | g1632.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 22 | 42 | 3.6E-25 |
| 5 | g1632.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 47 | 69 | 3.6E-25 |
| 7 | g1632.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 70 | 90 | 3.6E-25 |
| 6 | g1632.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 107 | 136 | 3.6E-25 |
| 3 | g1632.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 201 | 222 | 3.6E-25 |
| 15 | g1632.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 19 | - |
| 21 | g1632.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 43 | - |
| 12 | g1632.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 44 | 47 | - |
| 20 | g1632.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 48 | 66 | - |
| 17 | g1632.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 67 | 85 | - |
| 19 | g1632.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 86 | 104 | - |
| 13 | g1632.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 105 | 166 | - |
| 22 | g1632.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 167 | 185 | - |
| 16 | g1632.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 186 | 190 | - |
| 18 | g1632.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 191 | 214 | - |
| 14 | g1632.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 215 | 332 | - |
| 10 | g1632.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 21 | 43 | - |
| 9 | g1632.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 48 | 70 | - |
| 8 | g1632.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 167 | 184 | - |
| 11 | g1632.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 194 | 216 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
KEGG
Orthology
- This transcript has been annotated with K00507 (stearoyl-CoA desaturase (Delta-9 desaturase))
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed