General information for g16389.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Acyl-CoA desaturase 1.
Parent gene
- The parent gene g16389 is located on chr_4: 9317104..9317789 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16389 | g16389.t1 | isoform | g16389.t1 | 9313332 | 9317789 |
| chr_4 | g16389 | g16389.t1 | exon | g16389.t1.exon1 | 9313332 | 9313381 |
| chr_4 | g16389 | g16389.t1 | cds | g16389.t1.CDS1 | 9313332 | 9313381 |
| chr_4 | g16389 | g16389.t1 | exon | g16389.t1.exon2 | 9313552 | 9313563 |
| chr_4 | g16389 | g16389.t1 | cds | g16389.t1.CDS2 | 9313552 | 9313563 |
| chr_4 | g16389 | g16389.t1 | exon | g16389.t1.exon3 | 9313627 | 9313817 |
| chr_4 | g16389 | g16389.t1 | cds | g16389.t1.CDS3 | 9313627 | 9313817 |
| chr_4 | g16389 | g16389.t1 | exon | g16389.t1.exon4 | 9314409 | 9314539 |
| chr_4 | g16389 | g16389.t1 | cds | g16389.t1.CDS4 | 9314409 | 9314539 |
| chr_4 | g16389 | g16389.t1 | exon | g16389.t1.exon5 | 9315379 | 9315455 |
| chr_4 | g16389 | g16389.t1 | cds | g16389.t1.CDS5 | 9315379 | 9315455 |
| chr_4 | g16389 | g16389.t1 | exon | g16389.t1.exon6 | 9316625 | 9316650 |
| chr_4 | g16389 | g16389.t1 | cds | g16389.t1.CDS6 | 9316625 | 9316650 |
| chr_4 | g16389 | g16389.t1 | exon | g16389.t1.exon7 | 9317099 | 9317438 |
| chr_4 | g16389 | g16389.t1 | cds | g16389.t1.CDS7 | 9317099 | 9317438 |
| chr_4 | g16389 | g16389.t1 | exon | g16389.t1.exon8 | 9317501 | 9317789 |
| chr_4 | g16389 | g16389.t1 | cds | g16389.t1.CDS8 | 9317501 | 9317789 |
| chr_4 | g16389 | g16389.t1 | TTS | g16389.t1 | 9317882 | 9317882 |
| chr_4 | g16389 | g16389.t1 | TSS | g16389.t1 | NA | NA |
Sequences
>g16389.t1 Gene=g16389 Length=1116
ATGTTATTTTGCAAACCGGCATCGACGCCACTGACTTTATATGTTCCAATGAAGAAAAAA
ATGGCGCCTGACGCAAAAGTACATCAAAATGTGATGAAAACGGAGAGTGATGAAAATTTA
AAGTCTAATGCACCCTTTCGTGCTGAAATTCAATGGCGTAATGTTGCCGTCAACTTGTTT
ATTCATCTTGGTTTCTTCGTTGGACTCTATTATATAATTACATTCAAATTGCAACTAAAA
ACTTTCATTTACTTTTTCTTCCTGACATGCTTATGCAATTTGGGTGTCACGATCGGCGTT
CACAGATTATGGAGTCACAGAAGTTTCAAATGCACTCGTCCAATTAAGCTTCTTCTTACC
TTTTTTTACACAATGGCTGGTCAATCATCGATTTTCCATTGGGTTCAAATTCATCGAGTT
CATCATAAATTTTCTGAAACTTTAAAGGATCCATTAGATGTTAATCGTGGATTCTTTTTT
GCACATGTCGGTTGGTACTGTCTTTCATACCATCCAGAATGTGAAACTGAGATGAAGCGT
ATTGATATGGATGATATAAAGGCTGATAAAGACCTGATGTTCCAGTACAAGTACTATTCA
CATCTTTTCACACTTCTCAATTTCCTTTCCGTTCTTATTCCATGCTATTTTTGGGGCGAA
TCATTCAAAATTGCTTTTTGGGTTTGCTTTGTAACACGTTTTGCCATCAACTTTACACAA
TTAAATTTCACTAATAGTGCAAATCATTTCATTGGAAAACGTCCTTATGATAAAACTCAA
TCAGCTACTGACAACATTGCTTGCACTATTTTCTCATTTGGAGAAGGGTATCATAATTAT
CATCATGTCTTTCCTTATGATTACCGTACTGGTGAATTTGGTGACATTGGTCACTACAAT
CTCTCAGCTGTCATCATTGATTTCTGGTACAAAATGGGATGGGTTTGGGATCGTAAACTT
GTTTCACAAGACATGATCAATCGAAGAGTCTTAAGAACTGGCGATGGAAGTCATTGGTTG
TCACATGATGAAGCCCATAAAAATTCAATCTATGGTTATGGTGATAAAGATATTGATGAA
GCTGATCAGAAAGAATTAGAAAGAATGATTGGCTAA
>g16389.t1 Gene=g16389 Length=371
MLFCKPASTPLTLYVPMKKKMAPDAKVHQNVMKTESDENLKSNAPFRAEIQWRNVAVNLF
IHLGFFVGLYYIITFKLQLKTFIYFFFLTCLCNLGVTIGVHRLWSHRSFKCTRPIKLLLT
FFYTMAGQSSIFHWVQIHRVHHKFSETLKDPLDVNRGFFFAHVGWYCLSYHPECETEMKR
IDMDDIKADKDLMFQYKYYSHLFTLLNFLSVLIPCYFWGESFKIAFWVCFVTRFAINFTQ
LNFTNSANHFIGKRPYDKTQSATDNIACTIFSFGEGYHNYHHVFPYDYRTGEFGDIGHYN
LSAVIIDFWYKMGWVWDRKLVSQDMINRRVLRTGDGSHWLSHDEAHKNSIYGYGDKDIDE
ADQKELERMIG
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 25 | g16389.t1 | CDD | cd03505 | Delta9-FADS-like | 78 | 319 | 6.04402E-57 |
| 2 | g16389.t1 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 20 | 369 | 8.5E-114 |
| 3 | g16389.t1 | PANTHER | PTHR11351:SF61 | RH14937P | 20 | 369 | 8.5E-114 |
| 5 | g16389.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 52 | 72 | 3.1E-37 |
| 9 | g16389.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 101 | 121 | 3.1E-37 |
| 6 | g16389.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 138 | 167 | 3.1E-37 |
| 8 | g16389.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 198 | 216 | 3.1E-37 |
| 7 | g16389.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 231 | 252 | 3.1E-37 |
| 4 | g16389.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 274 | 288 | 3.1E-37 |
| 1 | g16389.t1 | Pfam | PF00487 | Fatty acid desaturase | 85 | 303 | 2.5E-19 |
| 14 | g16389.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 54 | - |
| 24 | g16389.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 55 | 75 | - |
| 18 | g16389.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 76 | 80 | - |
| 23 | g16389.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 81 | 104 | - |
| 15 | g16389.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 105 | 115 | - |
| 21 | g16389.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 116 | 135 | - |
| 19 | g16389.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 136 | 197 | - |
| 22 | g16389.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 198 | 217 | - |
| 16 | g16389.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 218 | 223 | - |
| 20 | g16389.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 224 | 243 | - |
| 17 | g16389.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 244 | 371 | - |
| 13 | g16389.t1 | ProSitePatterns | PS00476 | Fatty acid desaturases family 1 signature. | 274 | 288 | - |
| 12 | g16389.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 54 | 73 | - |
| 11 | g16389.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 83 | 105 | - |
| 10 | g16389.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 198 | 220 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
| GO:0006629 | lipid metabolic process | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
