General information for g16389.t10
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Acyl-CoA desaturase 2.
Parent gene
- The parent gene g16389 is located on chr_4: 9317104..9317789 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16389 | g16389.t10 | isoform | g16389.t10 | 9313332 | 9317789 |
| chr_4 | g16389 | g16389.t10 | exon | g16389.t10.exon1 | 9313332 | 9313563 |
| chr_4 | g16389 | g16389.t10 | cds | g16389.t10.CDS1 | 9313562 | 9313563 |
| chr_4 | g16389 | g16389.t10 | exon | g16389.t10.exon2 | 9313627 | 9313817 |
| chr_4 | g16389 | g16389.t10 | cds | g16389.t10.CDS2 | 9313627 | 9313817 |
| chr_4 | g16389 | g16389.t10 | exon | g16389.t10.exon3 | 9314409 | 9314539 |
| chr_4 | g16389 | g16389.t10 | cds | g16389.t10.CDS3 | 9314409 | 9314539 |
| chr_4 | g16389 | g16389.t10 | exon | g16389.t10.exon4 | 9315379 | 9315455 |
| chr_4 | g16389 | g16389.t10 | cds | g16389.t10.CDS4 | 9315379 | 9315455 |
| chr_4 | g16389 | g16389.t10 | exon | g16389.t10.exon5 | 9317079 | 9317438 |
| chr_4 | g16389 | g16389.t10 | cds | g16389.t10.CDS5 | 9317079 | 9317438 |
| chr_4 | g16389 | g16389.t10 | exon | g16389.t10.exon6 | 9317501 | 9317789 |
| chr_4 | g16389 | g16389.t10 | cds | g16389.t10.CDS6 | 9317501 | 9317789 |
| chr_4 | g16389 | g16389.t10 | TTS | g16389.t10 | 9317882 | 9317882 |
| chr_4 | g16389 | g16389.t10 | TSS | g16389.t10 | NA | NA |
Sequences
>g16389.t10 Gene=g16389 Length=1280
ATGTTATTTTGCAAACCGGCATCGACGCCACTGACTTTATATGTTCCAATGTGTGTGCAA
AAAAAAGTTTAAATTATTTTTTTCCGATTTTTTAGAACGTTCAGTTGACGTGCATCAGTC
TCGGGATATTGAAGTAATTTTTAGTTCTTCCCGTTTTTTAATTGTCGATTTTTTCTTTCG
TGCTTTGTGAATTTTTTTAAATTTAATTAATACAAAAAAGGAAGAAAAAAATGGCGCCTG
ACGCAAAAGTACATCAAAATGTGATGAAAACGGAGAGTGATGAAAATTTAAAGTCTAATG
CACCCTTTCGTGCTGAAATTCAATGGCGTAATGTTGCCGTCAACTTGTTTATTCATCTTG
GTTTCTTCGTTGGACTCTATTATATAATTACATTCAAATTGCAACTAAAAACTTTCATTT
ACTTTTTCTTCCTGACATGCTTATGCAATTTGGGTGTCACGATCGGCGTTCACAGATTAT
GGAGTCACAGAAGTTTCAAATGCACTCGTCCAATTAAGCTTCTTCTTACCTTTTTTTACA
CAATGGCTGGTCAATCATCGATTTTCCATTGGGTTCAAATTCATCGAGTTCATCATAAAT
TTTCTGAAACTTTAAAGGATCCATTAGATGTTAAATTTTTTTTTATTTTAGTCGGTTGGT
ACTGTCTTTCATACCATCCAGAATGTGAAACTGAGATGAAGCGTATTGATATGGATGATA
TAAAGGCTGATAAAGACCTGATGTTCCAGTACAAGTACTATTCACATCTTTTCACACTTC
TCAATTTCCTTTCCGTTCTTATTCCATGCTATTTTTGGGGCGAATCATTCAAAATTGCTT
TTTGGGTTTGCTTTGTAACACGTTTTGCCATCAACTTTACACAATTAAATTTCACTAATA
GTGCAAATCATTTCATTGGAAAACGTCCTTATGATAAAACTCAATCAGCTACTGACAACA
TTGCTTGCACTATTTTCTCATTTGGAGAAGGGTATCATAATTATCATCATGTCTTTCCTT
ATGATTACCGTACTGGTGAATTTGGTGACATTGGTCACTACAATCTCTCAGCTGTCATCA
TTGATTTCTGGTACAAAATGGGATGGGTTTGGGATCGTAAACTTGTTTCACAAGACATGA
TCAATCGAAGAGTCTTAAGAACTGGCGATGGAAGTCATTGGTTGTCACATGATGAAGCCC
ATAAAAATTCAATCTATGGTTATGGTGATAAAGATATTGATGAAGCTGATCAGAAAGAAT
TAGAAAGAATGATTGGCTAA
>g16389.t10 Gene=g16389 Length=349
MAPDAKVHQNVMKTESDENLKSNAPFRAEIQWRNVAVNLFIHLGFFVGLYYIITFKLQLK
TFIYFFFLTCLCNLGVTIGVHRLWSHRSFKCTRPIKLLLTFFYTMAGQSSIFHWVQIHRV
HHKFSETLKDPLDVKFFFILVGWYCLSYHPECETEMKRIDMDDIKADKDLMFQYKYYSHL
FTLLNFLSVLIPCYFWGESFKIAFWVCFVTRFAINFTQLNFTNSANHFIGKRPYDKTQSA
TDNIACTIFSFGEGYHNYHHVFPYDYRTGEFGDIGHYNLSAVIIDFWYKMGWVWDRKLVS
QDMINRRVLRTGDGSHWLSHDEAHKNSIYGYGDKDIDEADQKELERMIG
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 29 | g16389.t10 | CDD | cd03505 | Delta9-FADS-like | 58 | 297 | 2.37323E-50 |
| 2 | g16389.t10 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 7 | 347 | 1.4E-107 |
| 3 | g16389.t10 | PANTHER | PTHR11351:SF61 | RH14937P | 7 | 347 | 1.4E-107 |
| 4 | g16389.t10 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 32 | 52 | 2.6E-28 |
| 6 | g16389.t10 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 81 | 101 | 2.6E-28 |
| 9 | g16389.t10 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 118 | 147 | 2.6E-28 |
| 7 | g16389.t10 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 176 | 194 | 2.6E-28 |
| 5 | g16389.t10 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 209 | 230 | 2.6E-28 |
| 8 | g16389.t10 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 252 | 266 | 2.6E-28 |
| 1 | g16389.t10 | Pfam | PF00487 | Fatty acid desaturase | 65 | 281 | 6.3E-18 |
| 18 | g16389.t10 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 34 | - |
| 24 | g16389.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 35 | 55 | - |
| 21 | g16389.t10 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 56 | 60 | - |
| 28 | g16389.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 61 | 83 | - |
| 17 | g16389.t10 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 84 | 94 | - |
| 23 | g16389.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 95 | 114 | - |
| 22 | g16389.t10 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 115 | 133 | - |
| 25 | g16389.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 134 | 151 | - |
| 19 | g16389.t10 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 152 | 175 | - |
| 26 | g16389.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 176 | 197 | - |
| 20 | g16389.t10 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 198 | 202 | - |
| 27 | g16389.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 203 | 222 | - |
| 16 | g16389.t10 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 223 | 349 | - |
| 15 | g16389.t10 | ProSitePatterns | PS00476 | Fatty acid desaturases family 1 signature. | 252 | 266 | - |
| 14 | g16389.t10 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 35 | 57 | - |
| 10 | g16389.t10 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 62 | 84 | - |
| 12 | g16389.t10 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 97 | 116 | - |
| 13 | g16389.t10 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 131 | 148 | - |
| 11 | g16389.t10 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 176 | 198 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
| GO:0006629 | lipid metabolic process | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed