| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16389 | g16389.t26 | isoform | g16389.t26 | 9313332 | 9317789 |
| chr_4 | g16389 | g16389.t26 | exon | g16389.t26.exon1 | 9313332 | 9313568 |
| chr_4 | g16389 | g16389.t26 | exon | g16389.t26.exon2 | 9313627 | 9313817 |
| chr_4 | g16389 | g16389.t26 | cds | g16389.t26.CDS1 | 9313658 | 9313817 |
| chr_4 | g16389 | g16389.t26 | exon | g16389.t26.exon3 | 9314409 | 9314539 |
| chr_4 | g16389 | g16389.t26 | cds | g16389.t26.CDS2 | 9314409 | 9314539 |
| chr_4 | g16389 | g16389.t26 | exon | g16389.t26.exon4 | 9315379 | 9315455 |
| chr_4 | g16389 | g16389.t26 | cds | g16389.t26.CDS3 | 9315379 | 9315455 |
| chr_4 | g16389 | g16389.t26 | exon | g16389.t26.exon5 | 9317079 | 9317438 |
| chr_4 | g16389 | g16389.t26 | cds | g16389.t26.CDS4 | 9317079 | 9317438 |
| chr_4 | g16389 | g16389.t26 | exon | g16389.t26.exon6 | 9317501 | 9317789 |
| chr_4 | g16389 | g16389.t26 | cds | g16389.t26.CDS5 | 9317501 | 9317789 |
| chr_4 | g16389 | g16389.t26 | TTS | g16389.t26 | 9317882 | 9317882 |
| chr_4 | g16389 | g16389.t26 | TSS | g16389.t26 | NA | NA |
>g16389.t26 Gene=g16389 Length=1285
ATGTTATTTTGCAAACCGGCATCGACGCCACTGACTTTATATGTTCCAATGTGTGTGCAA
AAAAAAGTTTAAATTATTTTTTTCCGATTTTTTAGAACGTTCAGTTGACGTGCATCAGTC
TCGGGATATTGAAGTAATTTTTAGTTCTTCCCGTTTTTTAATTGTCGATTTTTTCTTTCG
TGCTTTGTGAATTTTTTTAAATTTAATTAATACAAAAAAGGAAGAAAAAAATGTAAAGGC
GCCTGACGCAAAAGTACATCAAAATGTGATGAAAACGGAGAGTGATGAAAATTTAAAGTC
TAATGCACCCTTTCGTGCTGAAATTCAATGGCGTAATGTTGCCGTCAACTTGTTTATTCA
TCTTGGTTTCTTCGTTGGACTCTATTATATAATTACATTCAAATTGCAACTAAAAACTTT
CATTTACTTTTTCTTCCTGACATGCTTATGCAATTTGGGTGTCACGATCGGCGTTCACAG
ATTATGGAGTCACAGAAGTTTCAAATGCACTCGTCCAATTAAGCTTCTTCTTACCTTTTT
TTACACAATGGCTGGTCAATCATCGATTTTCCATTGGGTTCAAATTCATCGAGTTCATCA
TAAATTTTCTGAAACTTTAAAGGATCCATTAGATGTTAAATTTTTTTTTATTTTAGTCGG
TTGGTACTGTCTTTCATACCATCCAGAATGTGAAACTGAGATGAAGCGTATTGATATGGA
TGATATAAAGGCTGATAAAGACCTGATGTTCCAGTACAAGTACTATTCACATCTTTTCAC
ACTTCTCAATTTCCTTTCCGTTCTTATTCCATGCTATTTTTGGGGCGAATCATTCAAAAT
TGCTTTTTGGGTTTGCTTTGTAACACGTTTTGCCATCAACTTTACACAATTAAATTTCAC
TAATAGTGCAAATCATTTCATTGGAAAACGTCCTTATGATAAAACTCAATCAGCTACTGA
CAACATTGCTTGCACTATTTTCTCATTTGGAGAAGGGTATCATAATTATCATCATGTCTT
TCCTTATGATTACCGTACTGGTGAATTTGGTGACATTGGTCACTACAATCTCTCAGCTGT
CATCATTGATTTCTGGTACAAAATGGGATGGGTTTGGGATCGTAAACTTGTTTCACAAGA
CATGATCAATCGAAGAGTCTTAAGAACTGGCGATGGAAGTCATTGGTTGTCACATGATGA
AGCCCATAAAAATTCAATCTATGGTTATGGTGATAAAGATATTGATGAAGCTGATCAGAA
AGAATTAGAAAGAATGATTGGCTAA
>g16389.t26 Gene=g16389 Length=338
MKTESDENLKSNAPFRAEIQWRNVAVNLFIHLGFFVGLYYIITFKLQLKTFIYFFFLTCL
CNLGVTIGVHRLWSHRSFKCTRPIKLLLTFFYTMAGQSSIFHWVQIHRVHHKFSETLKDP
LDVKFFFILVGWYCLSYHPECETEMKRIDMDDIKADKDLMFQYKYYSHLFTLLNFLSVLI
PCYFWGESFKIAFWVCFVTRFAINFTQLNFTNSANHFIGKRPYDKTQSATDNIACTIFSF
GEGYHNYHHVFPYDYRTGEFGDIGHYNLSAVIIDFWYKMGWVWDRKLVSQDMINRRVLRT
GDGSHWLSHDEAHKNSIYGYGDKDIDEADQKELERMIG
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 29 | g16389.t26 | CDD | cd03505 | Delta9-FADS-like | 47 | 286 | 3.21372E-50 |
| 2 | g16389.t26 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 6 | 336 | 1.1E-106 |
| 3 | g16389.t26 | PANTHER | PTHR11351:SF61 | RH14937P | 6 | 336 | 1.1E-106 |
| 6 | g16389.t26 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 21 | 41 | 2.3E-28 |
| 9 | g16389.t26 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 70 | 90 | 2.3E-28 |
| 8 | g16389.t26 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 107 | 136 | 2.3E-28 |
| 4 | g16389.t26 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 165 | 183 | 2.3E-28 |
| 5 | g16389.t26 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 198 | 219 | 2.3E-28 |
| 7 | g16389.t26 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 241 | 255 | 2.3E-28 |
| 1 | g16389.t26 | Pfam | PF00487 | Fatty acid desaturase | 54 | 270 | 5.0E-18 |
| 19 | g16389.t26 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 23 | - |
| 25 | g16389.t26 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 24 | 44 | - |
| 21 | g16389.t26 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 45 | 49 | - |
| 24 | g16389.t26 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 50 | 72 | - |
| 17 | g16389.t26 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 73 | 83 | - |
| 23 | g16389.t26 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 84 | 103 | - |
| 22 | g16389.t26 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 104 | 122 | - |
| 27 | g16389.t26 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 123 | 140 | - |
| 16 | g16389.t26 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 141 | 164 | - |
| 28 | g16389.t26 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 165 | 186 | - |
| 20 | g16389.t26 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 187 | 191 | - |
| 26 | g16389.t26 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 192 | 211 | - |
| 18 | g16389.t26 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 212 | 338 | - |
| 15 | g16389.t26 | ProSitePatterns | PS00476 | Fatty acid desaturases family 1 signature. | 241 | 255 | - |
| 11 | g16389.t26 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 24 | 46 | - |
| 13 | g16389.t26 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 51 | 73 | - |
| 10 | g16389.t26 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 86 | 105 | - |
| 14 | g16389.t26 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 120 | 137 | - |
| 12 | g16389.t26 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 165 | 187 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
| GO:0006629 | lipid metabolic process | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed