| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16389 | g16389.t54 | isoform | g16389.t54 | 9315434 | 9317789 |
| chr_4 | g16389 | g16389.t54 | exon | g16389.t54.exon1 | 9315434 | 9315455 |
| chr_4 | g16389 | g16389.t54 | exon | g16389.t54.exon2 | 9316625 | 9316650 |
| chr_4 | g16389 | g16389.t54 | exon | g16389.t54.exon3 | 9317099 | 9317438 |
| chr_4 | g16389 | g16389.t54 | cds | g16389.t54.CDS1 | 9317143 | 9317438 |
| chr_4 | g16389 | g16389.t54 | exon | g16389.t54.exon4 | 9317501 | 9317789 |
| chr_4 | g16389 | g16389.t54 | cds | g16389.t54.CDS2 | 9317501 | 9317789 |
| chr_4 | g16389 | g16389.t54 | TTS | g16389.t54 | 9317882 | 9317882 |
| chr_4 | g16389 | g16389.t54 | TSS | g16389.t54 | NA | NA |
>g16389.t54 Gene=g16389 Length=677
CTTTAAAGGATCCATTAGATGTTAATCGTGGATTCTTTTTTGCACATGTCGGTTGGTACT
GTCTTTCATACCATCCAGAATGTGAAACTGAGATGAAGCGTATTGATATGGATGATATAA
AGGCTGATAAAGACCTGATGTTCCAGTACAAGTACTATTCACATCTTTTCACACTTCTCA
ATTTCCTTTCCGTTCTTATTCCATGCTATTTTTGGGGCGAATCATTCAAAATTGCTTTTT
GGGTTTGCTTTGTAACACGTTTTGCCATCAACTTTACACAATTAAATTTCACTAATAGTG
CAAATCATTTCATTGGAAAACGTCCTTATGATAAAACTCAATCAGCTACTGACAACATTG
CTTGCACTATTTTCTCATTTGGAGAAGGGTATCATAATTATCATCATGTCTTTCCTTATG
ATTACCGTACTGGTGAATTTGGTGACATTGGTCACTACAATCTCTCAGCTGTCATCATTG
ATTTCTGGTACAAAATGGGATGGGTTTGGGATCGTAAACTTGTTTCACAAGACATGATCA
ATCGAAGAGTCTTAAGAACTGGCGATGGAAGTCATTGGTTGTCACATGATGAAGCCCATA
AAAATTCAATCTATGGTTATGGTGATAAAGATATTGATGAAGCTGATCAGAAAGAATTAG
AAAGAATGATTGGCTAA
>g16389.t54 Gene=g16389 Length=194
MKRIDMDDIKADKDLMFQYKYYSHLFTLLNFLSVLIPCYFWGESFKIAFWVCFVTRFAIN
FTQLNFTNSANHFIGKRPYDKTQSATDNIACTIFSFGEGYHNYHHVFPYDYRTGEFGDIG
HYNLSAVIIDFWYKMGWVWDRKLVSQDMINRRVLRTGDGSHWLSHDEAHKNSIYGYGDKD
IDEADQKELERMIG
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g16389.t54 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 2 | 192 | 9.0E-63 |
| 3 | g16389.t54 | PANTHER | PTHR11351:SF61 | RH14937P | 2 | 192 | 9.0E-63 |
| 6 | g16389.t54 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 21 | 39 | 3.0E-9 |
| 5 | g16389.t54 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 54 | 75 | 3.0E-9 |
| 4 | g16389.t54 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 97 | 111 | 3.0E-9 |
| 1 | g16389.t54 | Pfam | PF00487 | Fatty acid desaturase | 11 | 126 | 1.2E-10 |
| 9 | g16389.t54 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 20 | - |
| 13 | g16389.t54 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 21 | 42 | - |
| 11 | g16389.t54 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 43 | 47 | - |
| 12 | g16389.t54 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 48 | 67 | - |
| 10 | g16389.t54 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 68 | 194 | - |
| 8 | g16389.t54 | ProSitePatterns | PS00476 | Fatty acid desaturases family 1 signature. | 97 | 111 | - |
| 7 | g16389.t54 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 21 | 43 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
| GO:0006629 | lipid metabolic process | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.