Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Acyl-CoA Delta(11) desaturase.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_4 g16389 g16389.t55 isoform g16389.t55 9317104 9317789
chr_4 g16389 g16389.t55 exon g16389.t55.exon1 9317104 9317438
chr_4 g16389 g16389.t55 cds g16389.t55.CDS1 9317143 9317438
chr_4 g16389 g16389.t55 exon g16389.t55.exon2 9317501 9317789
chr_4 g16389 g16389.t55 cds g16389.t55.CDS2 9317501 9317789
chr_4 g16389 g16389.t55 TTS g16389.t55 9317882 9317882
chr_4 g16389 g16389.t55 TSS g16389.t55 NA NA

Sequences

>g16389.t55 Gene=g16389 Length=624
TGGTACTGTCTTTCATACCATCCAGAATGTGAAACTGAGATGAAGCGTATTGATATGGAT
GATATAAAGGCTGATAAAGACCTGATGTTCCAGTACAAGTACTATTCACATCTTTTCACA
CTTCTCAATTTCCTTTCCGTTCTTATTCCATGCTATTTTTGGGGCGAATCATTCAAAATT
GCTTTTTGGGTTTGCTTTGTAACACGTTTTGCCATCAACTTTACACAATTAAATTTCACT
AATAGTGCAAATCATTTCATTGGAAAACGTCCTTATGATAAAACTCAATCAGCTACTGAC
AACATTGCTTGCACTATTTTCTCATTTGGAGAAGGGTATCATAATTATCATCATGTCTTT
CCTTATGATTACCGTACTGGTGAATTTGGTGACATTGGTCACTACAATCTCTCAGCTGTC
ATCATTGATTTCTGGTACAAAATGGGATGGGTTTGGGATCGTAAACTTGTTTCACAAGAC
ATGATCAATCGAAGAGTCTTAAGAACTGGCGATGGAAGTCATTGGTTGTCACATGATGAA
GCCCATAAAAATTCAATCTATGGTTATGGTGATAAAGATATTGATGAAGCTGATCAGAAA
GAATTAGAAAGAATGATTGGCTAA

>g16389.t55 Gene=g16389 Length=194
MKRIDMDDIKADKDLMFQYKYYSHLFTLLNFLSVLIPCYFWGESFKIAFWVCFVTRFAIN
FTQLNFTNSANHFIGKRPYDKTQSATDNIACTIFSFGEGYHNYHHVFPYDYRTGEFGDIG
HYNLSAVIIDFWYKMGWVWDRKLVSQDMINRRVLRTGDGSHWLSHDEAHKNSIYGYGDKD
IDEADQKELERMIG

Protein features from InterProScan

Transcript Database ID Name Start End E.value
2 g16389.t55 PANTHER PTHR11351 ACYL-COA DESATURASE 2 192 9.0E-63
3 g16389.t55 PANTHER PTHR11351:SF61 RH14937P 2 192 9.0E-63
6 g16389.t55 PRINTS PR00075 Fatty acid desaturase family 1 signature 21 39 3.0E-9
5 g16389.t55 PRINTS PR00075 Fatty acid desaturase family 1 signature 54 75 3.0E-9
4 g16389.t55 PRINTS PR00075 Fatty acid desaturase family 1 signature 97 111 3.0E-9
1 g16389.t55 Pfam PF00487 Fatty acid desaturase 11 126 1.2E-10
9 g16389.t55 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 1 20 -
13 g16389.t55 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 21 42 -
11 g16389.t55 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 43 47 -
12 g16389.t55 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 48 67 -
10 g16389.t55 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 68 194 -
8 g16389.t55 ProSitePatterns PS00476 Fatty acid desaturases family 1 signature. 97 111 -
7 g16389.t55 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 21 43 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0055114 NA NA
GO:0016717 oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water MF
GO:0006629 lipid metabolic process BP

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values