| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16389 | g16389.t6 | isoform | g16389.t6 | 9313332 | 9317099 |
| chr_4 | g16389 | g16389.t6 | exon | g16389.t6.exon1 | 9313332 | 9313563 |
| chr_4 | g16389 | g16389.t6 | cds | g16389.t6.CDS1 | 9313562 | 9313563 |
| chr_4 | g16389 | g16389.t6 | exon | g16389.t6.exon2 | 9313627 | 9313817 |
| chr_4 | g16389 | g16389.t6 | cds | g16389.t6.CDS2 | 9313627 | 9313817 |
| chr_4 | g16389 | g16389.t6 | exon | g16389.t6.exon3 | 9314409 | 9314539 |
| chr_4 | g16389 | g16389.t6 | cds | g16389.t6.CDS3 | 9314409 | 9314539 |
| chr_4 | g16389 | g16389.t6 | exon | g16389.t6.exon4 | 9315379 | 9315455 |
| chr_4 | g16389 | g16389.t6 | cds | g16389.t6.CDS4 | 9315379 | 9315455 |
| chr_4 | g16389 | g16389.t6 | exon | g16389.t6.exon5 | 9317079 | 9317099 |
| chr_4 | g16389 | g16389.t6 | cds | g16389.t6.CDS5 | 9317079 | 9317097 |
| chr_4 | g16389 | g16389.t6 | TTS | g16389.t6 | 9317882 | 9317882 |
| chr_4 | g16389 | g16389.t6 | TSS | g16389.t6 | NA | NA |
>g16389.t6 Gene=g16389 Length=652
ATGTTATTTTGCAAACCGGCATCGACGCCACTGACTTTATATGTTCCAATGTGTGTGCAA
AAAAAAGTTTAAATTATTTTTTTCCGATTTTTTAGAACGTTCAGTTGACGTGCATCAGTC
TCGGGATATTGAAGTAATTTTTAGTTCTTCCCGTTTTTTAATTGTCGATTTTTTCTTTCG
TGCTTTGTGAATTTTTTTAAATTTAATTAATACAAAAAAGGAAGAAAAAAATGGCGCCTG
ACGCAAAAGTACATCAAAATGTGATGAAAACGGAGAGTGATGAAAATTTAAAGTCTAATG
CACCCTTTCGTGCTGAAATTCAATGGCGTAATGTTGCCGTCAACTTGTTTATTCATCTTG
GTTTCTTCGTTGGACTCTATTATATAATTACATTCAAATTGCAACTAAAAACTTTCATTT
ACTTTTTCTTCCTGACATGCTTATGCAATTTGGGTGTCACGATCGGCGTTCACAGATTAT
GGAGTCACAGAAGTTTCAAATGCACTCGTCCAATTAAGCTTCTTCTTACCTTTTTTTACA
CAATGGCTGGTCAATCATCGATTTTCCATTGGGTTCAAATTCATCGAGTTCATCATAAAT
TTTCTGAAACTTTAAAGGATCCATTAGATGTTAAATTTTTTTTTATTTTAGT
>g16389.t6 Gene=g16389 Length=140
MAPDAKVHQNVMKTESDENLKSNAPFRAEIQWRNVAVNLFIHLGFFVGLYYIITFKLQLK
TFIYFFFLTCLCNLGVTIGVHRLWSHRSFKCTRPIKLLLTFFYTMAGQSSIFHWVQIHRV
HHKFSETLKDPLDVKFFFIL
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g16389.t6 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 9 | 138 | 1.6E-33 |
| 2 | g16389.t6 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 32 | 52 | 3.7E-16 |
| 3 | g16389.t6 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 81 | 101 | 3.7E-16 |
| 4 | g16389.t6 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 118 | 140 | 3.7E-16 |
| 9 | g16389.t6 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 34 | - |
| 13 | g16389.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 35 | 55 | - |
| 10 | g16389.t6 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 56 | 60 | - |
| 14 | g16389.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 61 | 84 | - |
| 8 | g16389.t6 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 85 | 95 | - |
| 12 | g16389.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 96 | 115 | - |
| 11 | g16389.t6 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 116 | 140 | - |
| 6 | g16389.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 34 | 53 | - |
| 7 | g16389.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 63 | 85 | - |
| 5 | g16389.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 98 | 117 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.