Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_4 g16394 g16394.t2 TSS g16394.t2 9323582 9323582
chr_4 g16394 g16394.t2 isoform g16394.t2 9323612 9324054
chr_4 g16394 g16394.t2 exon g16394.t2.exon1 9323612 9324054
chr_4 g16394 g16394.t2 cds g16394.t2.CDS1 9323612 9324052
chr_4 g16394 g16394.t2 TTS g16394.t2 9324913 9324913

Sequences

>g16394.t2 Gene=g16394 Length=443
ATGAAGTTCTTTCTTTTAACAATTTTTGCAATCGCTGTTGTGTCAGCAGTTGAAGATTAT
AATGCACCAGAATGGCAACCAATTGATTGGGCAAAAGTAATTCCTGCTGATGAGTTGCCA
GGTTTCTGGGAAAATACAGTTTTCGCTCAACTTGCACCAAGATCAAACAGAGAGCGCAGA
ATTGTTGGTGGTCATGAAGCAACACCACATGCTCATCCATATCAAGTCGCTCTGATTCAT
CAACGTGTAATCTTGGCTACAATGTGTGGTGGTTCAGTTATTAGTCCAACTGTTATTCTC
ACAGCTGCTCATTGTCCAATTGGTTCACAATCATCAACTGTCATCACTGGAGCACATAAT
ATGAATGTAATTGAACCAAATCAACAACGTAGAACTGTTCAATCAGCACAATATCGTATT
CATGCTAATTATAATTCACAAAA

>g16394.t2 Gene=g16394 Length=147
MKFFLLTIFAIAVVSAVEDYNAPEWQPIDWAKVIPADELPGFWENTVFAQLAPRSNRERR
IVGGHEATPHAHPYQVALIHQRVILATMCGGSVISPTVILTAAHCPIGSQSSTVITGAHN
MNVIEPNQQRRTVQSAQYRIHANYNSQ

Protein features from InterProScan

Transcript Database ID Name Start End E.value
6 g16394.t2 Gene3D G3DSA:2.40.10.10 - 61 146 1.1E-19
2 g16394.t2 PANTHER PTHR24250:SF56 SERINE PROTEASE P96 9 146 2.8E-28
3 g16394.t2 PANTHER PTHR24250 CHYMOTRYPSIN-RELATED 9 146 2.8E-28
1 g16394.t2 Pfam PF00089 Trypsin 61 146 3.7E-18
8 g16394.t2 Phobius SIGNAL_PEPTIDE Signal peptide region 1 16 -
9 g16394.t2 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide. 1 2 -
10 g16394.t2 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide. 3 11 -
11 g16394.t2 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide. 12 16 -
7 g16394.t2 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 17 147 -
12 g16394.t2 ProSitePatterns PS00134 Serine proteases, trypsin family, histidine active site. 100 105 -
13 g16394.t2 ProSiteProfiles PS50240 Serine proteases, trypsin domain profile. 61 147 10.537
4 g16394.t2 SUPERFAMILY SSF50494 Trypsin-like serine proteases 53 146 2.5E-23
5 g16394.t2 SignalP_EUK SignalP-noTM SignalP-noTM 1 16 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0004252 serine-type endopeptidase activity MF
GO:0006508 proteolysis BP

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed