General information for g16398.t51
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g16398 is located on chr_4: 9341613..9346552 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16398 | g16398.t51 | TSS | g16398.t51 | 9340829 | 9340829 |
| chr_4 | g16398 | g16398.t51 | isoform | g16398.t51 | 9341613 | 9342001 |
| chr_4 | g16398 | g16398.t51 | exon | g16398.t51.exon1 | 9341613 | 9341767 |
| chr_4 | g16398 | g16398.t51 | cds | g16398.t51.CDS1 | 9341613 | 9341767 |
| chr_4 | g16398 | g16398.t51 | exon | g16398.t51.exon2 | 9341830 | 9342001 |
| chr_4 | g16398 | g16398.t51 | cds | g16398.t51.CDS2 | 9341830 | 9342001 |
| chr_4 | g16398 | g16398.t51 | TTS | g16398.t51 | 9342130 | 9342130 |
Sequences
>g16398.t51 Gene=g16398 Length=327
GGAAGAACAACTAACACTGGTGCAACCTCAGCTGTCCTTCGTAAGGCTTACAATCCAGTC
ATTACTAATGCTGCTTGCTCAGCTGTCTATGGTGGATCAGTTGTAATTGCTTCAGTCATT
TGCATTGCTACAAGCGGTGTCAACCAAGGAACATGCAACGGTGACTCAGGCGGTGTCCTT
TCAGTTCCAAGAGCTGGAGATACTCGTCCAATCCAAATTGGTGTTACATCATTCGTCGCT
GCAGCTGGTTGCGTTGCTGGATTCCCATCAGGCTTCGCAAGAGTTACATCATTCCTTACC
TGGATTAACAACAACCAAAATCCATAA
>g16398.t51 Gene=g16398 Length=108
GRTTNTGATSAVLRKAYNPVITNAACSAVYGGSVVIASVICIATSGVNQGTCNGDSGGVL
SVPRAGDTRPIQIGVTSFVAAAGCVAGFPSGFARVTSFLTWINNNQNP
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g16398.t51 | Gene3D | G3DSA:2.40.10.10 | - | 1 | 98 | 8.6E-22 |
| 2 | g16398.t51 | PANTHER | PTHR24250:SF56 | SERINE PROTEASE P96 | 1 | 105 | 3.8E-28 |
| 3 | g16398.t51 | PANTHER | PTHR24250 | CHYMOTRYPSIN-RELATED | 1 | 105 | 3.8E-28 |
| 1 | g16398.t51 | Pfam | PF00089 | Trypsin | 1 | 102 | 6.0E-14 |
| 7 | g16398.t51 | ProSitePatterns | PS00135 | Serine proteases, trypsin family, serine active site. | 50 | 61 | - |
| 9 | g16398.t51 | ProSiteProfiles | PS50240 | Serine proteases, trypsin domain profile. | 1 | 107 | 11.315 |
| 6 | g16398.t51 | SUPERFAMILY | SSF50494 | Trypsin-like serine proteases | 1 | 106 | 2.0E-23 |
| 4 | g16398.t51 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 42 | - |
| 5 | g16398.t51 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 71 | 93 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0004252 | serine-type endopeptidase activity | MF |
| GO:0006508 | proteolysis | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed