| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16398 | g16398.t9 | TSS | g16398.t9 | 9340829 | 9340829 |
| chr_4 | g16398 | g16398.t9 | isoform | g16398.t9 | 9340865 | 9341546 |
| chr_4 | g16398 | g16398.t9 | exon | g16398.t9.exon1 | 9340865 | 9341153 |
| chr_4 | g16398 | g16398.t9 | cds | g16398.t9.CDS1 | 9340865 | 9341153 |
| chr_4 | g16398 | g16398.t9 | exon | g16398.t9.exon2 | 9341214 | 9341364 |
| chr_4 | g16398 | g16398.t9 | cds | g16398.t9.CDS2 | 9341214 | 9341284 |
| chr_4 | g16398 | g16398.t9 | exon | g16398.t9.exon3 | 9341430 | 9341546 |
| chr_4 | g16398 | g16398.t9 | TTS | g16398.t9 | 9342130 | 9342130 |
>g16398.t9 Gene=g16398 Length=557
ATGAAACTCTTGCTTCTCGCACTTTTCGCTGCTGTGGCACTTGCCCAGGAAAACTATGAT
GGACCAGAATACGCTCCATTTGATGCCTCAGAAATCATCCCAGTTGAAGATTTCCCAGGT
TTCTGGACAATCGTGAATTCCCAAAAGAAGTTTTCACACCAAATCCACGTGCCTCAAGAA
TTGTCGGTGGTGTTGAAGTTGTTCCACACAGCCATCCATACCAAGTTGCCCTTCACATGC
AATTCGGTACTGGCACTGGTCTCTGCCGGTGGTTCAGTTTCTTTTGACCGCTGCTCATTG
TCCAATTGGTTCAAGCTCAACCTTGGTCATTGCTGGTGCTCACAACAGAAATGTCGTTGA
ACCAAATCAACAACGTCGTACTGTTCCATCATCAGGCTACCGCATCCACGCCAACTACAA
CCCATCAAACTTGAACAATGATATCGCTATCCTCATCACACCAACACCAAACTTTGCCTT
CGGTGCACATGTTCAAGCCGCTCGTATGCCAACTGCTTTTGCTAGTGAACTTTTCGTCGG
TGAAACTGCCCGCTCAA
>g16398.t9 Gene=g16398 Length=119
MKLLLLALFAAVALAQENYDGPEYAPFDASEIIPVEDFPGFWTIVNSQKKFSHQIHVPQE
LSVVLKLFHTAIHTKLPFTCNSVLALVSAGGSVSFDRCSLSNWFKLNLGHCWCSQQKCR
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g16398.t9 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 15 | - |
| 5 | g16398.t9 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 2 | - |
| 6 | g16398.t9 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 3 | 10 | - |
| 7 | g16398.t9 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 11 | 15 | - |
| 3 | g16398.t9 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 16 | 119 | - |
| 2 | g16398.t9 | SignalP_EUK | SignalP-noTM | SignalP-noTM | 1 | 15 | - |
| 1 | g16398.t9 | SignalP_GRAM_NEGATIVE | SignalP-noTM | SignalP-noTM | 1 | 15 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed