Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Protein BUD31-like protein.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g1640 g1640.t3 TSS g1640.t3 12270481 12270481
chr_3 g1640 g1640.t3 isoform g1640.t3 12270531 12271018
chr_3 g1640 g1640.t3 exon g1640.t3.exon1 12270531 12270624
chr_3 g1640 g1640.t3 cds g1640.t3.CDS1 12270531 12270624
chr_3 g1640 g1640.t3 exon g1640.t3.exon2 12270684 12270777
chr_3 g1640 g1640.t3 cds g1640.t3.CDS2 12270684 12270777
chr_3 g1640 g1640.t3 exon g1640.t3.exon3 12270892 12271018
chr_3 g1640 g1640.t3 cds g1640.t3.CDS3 12270892 12271018
chr_3 g1640 g1640.t3 TTS g1640.t3 12271128 12271128

Sequences

>g1640.t3 Gene=g1640 Length=315
ATGCCGAAAGTAAGGAGAAGCAAAAAAAGGCCACCAGAAGGATGGGATTTAATCGAAGAA
ACTCTTGAAAGTATGGAACAAAAGATGAGAGAAGCTGAAACTGAGCCACATGAAGGAAAG
AGAATAAATGAATCACTCTGGCCTATCTTTAAAATACACCATCAAAAGACTCGCTATATC
TATGACATCTGTCTCAGATGCATACAGACTCGTGACACAAATTTCGGAACAAACTGCATT
TGTCGAGTACCAAAATCAAAACTCGAAGAAGGAAAAATTGTCGAATGTGTTCACTGTGGT
TGTCGTGGATGCTAA

>g1640.t3 Gene=g1640 Length=104
MPKVRRSKKRPPEGWDLIEETLESMEQKMREAETEPHEGKRINESLWPIFKIHHQKTRYI
YDICLRCIQTRDTNFGTNCICRVPKSKLEEGKIVECVHCGCRGC

Protein features from InterProScan

Transcript Database ID Name Start End E.value
9 g1640.t3 Coils Coil Coil 15 35 -
4 g1640.t3 PANTHER PTHR19411 PROTEIN BUD31-RELATED 1 62 1.1E-38
6 g1640.t3 PANTHER PTHR19411:SF0 PROTEIN BUD31 HOMOLOG 1 62 1.1E-38
3 g1640.t3 PANTHER PTHR19411 PROTEIN BUD31-RELATED 63 104 1.1E-38
5 g1640.t3 PANTHER PTHR19411:SF0 PROTEIN BUD31 HOMOLOG 63 104 1.1E-38
8 g1640.t3 PRINTS PR00322 G10 protein signature 12 32 4.6E-15
7 g1640.t3 PRINTS PR00322 G10 protein signature 47 70 4.6E-15
1 g1640.t3 Pfam PF01125 G10 protein 1 65 1.3E-20
2 g1640.t3 Pfam PF01125 G10 protein 64 104 1.7E-13

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0005634 nucleus CC

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed