| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1641 | g1641.t1 | TTS | g1641.t1 | 12271065 | 12271065 |
| chr_3 | g1641 | g1641.t1 | isoform | g1641.t1 | 12271182 | 12271799 |
| chr_3 | g1641 | g1641.t1 | exon | g1641.t1.exon1 | 12271182 | 12271480 |
| chr_3 | g1641 | g1641.t1 | cds | g1641.t1.CDS1 | 12271182 | 12271480 |
| chr_3 | g1641 | g1641.t1 | exon | g1641.t1.exon2 | 12271539 | 12271679 |
| chr_3 | g1641 | g1641.t1 | cds | g1641.t1.CDS2 | 12271539 | 12271679 |
| chr_3 | g1641 | g1641.t1 | exon | g1641.t1.exon3 | 12271739 | 12271799 |
| chr_3 | g1641 | g1641.t1 | cds | g1641.t1.CDS3 | 12271739 | 12271799 |
| chr_3 | g1641 | g1641.t1 | TSS | g1641.t1 | 12271884 | 12271884 |
>g1641.t1 Gene=g1641 Length=501
ATGGCTGACGTTTTAGATATTGATAATGCTGAAGATTTTGAGGTTGATGATGATGGTGAT
CAGGGAATTTTGCGATTAAAAGAAAAAGCAAAGAAGAAAAAAGGTCGTGGATTTGGAGCT
GATACAATCCATCGTGAAACAATTGATTATGAAAGTGTACGTGATGATACCAATGAAGAT
GTTGAACCAGGCCCACAAAGATCTGTAGAAGGCTGGATCTTGTTTATTACATCAATACAT
GAAGAGGCACATGAGGATGATATTCAAGAGAAATTCTGTGAATTTGGAGATATCAAAAAC
ATTCATCTTAATCTCGATCGAAGAACTGGCTTTCTTAAAGGATATGCTCTAGTCGAATAT
GAGACTTATAAGCAAGCACTTGCAGCTAAAGAAGCAATGGATGGTGCAGAAATTTTGGGA
CAAAAAATCAGTGTCGATTGGTGTTTCGTGAAAGGTCCGAAAAGATCGAGAAAAGGTGCT
GATCGCAAAAAGAAGCAGTAA
>g1641.t1 Gene=g1641 Length=166
MADVLDIDNAEDFEVDDDGDQGILRLKEKAKKKKGRGFGADTIHRETIDYESVRDDTNED
VEPGPQRSVEGWILFITSIHEEAHEDDIQEKFCEFGDIKNIHLNLDRRTGFLKGYALVEY
ETYKQALAAKEAMDGAEILGQKISVDWCFVKGPKRSRKGADRKKKQ
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g1641.t1 | CDD | cd12324 | RRM_RBM8 | 66 | 153 | 0.000 |
| 9 | g1641.t1 | Gene3D | G3DSA:3.30.70.330 | - | 1 | 164 | 0.000 |
| 2 | g1641.t1 | PANTHER | PTHR45894:SF1 | RNA-BINDING PROTEIN 8A | 2 | 162 | 0.000 |
| 3 | g1641.t1 | PANTHER | PTHR45894 | RNA-BINDING PROTEIN 8A | 2 | 162 | 0.000 |
| 6 | g1641.t1 | PRINTS | PR01738 | RNA binding motif protein 8 family signature | 27 | 39 | 0.000 |
| 4 | g1641.t1 | PRINTS | PR01738 | RNA binding motif protein 8 family signature | 63 | 77 | 0.000 |
| 5 | g1641.t1 | PRINTS | PR01738 | RNA binding motif protein 8 family signature | 119 | 135 | 0.000 |
| 7 | g1641.t1 | PRINTS | PR01738 | RNA binding motif protein 8 family signature | 137 | 149 | 0.000 |
| 1 | g1641.t1 | Pfam | PF00076 | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) | 74 | 143 | 0.000 |
| 12 | g1641.t1 | ProSiteProfiles | PS50102 | Eukaryotic RNA Recognition Motif (RRM) profile. | 72 | 150 | 14.266 |
| 11 | g1641.t1 | SMART | SM00360 | rrm1_1 | 73 | 146 | 0.000 |
| 8 | g1641.t1 | SUPERFAMILY | SSF54928 | RNA-binding domain, RBD | 57 | 159 | 0.000 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006396 | RNA processing | BP |
| GO:0005634 | nucleus | CC |
| GO:0003729 | mRNA binding | MF |
| GO:0003723 | RNA binding | MF |
| GO:0005737 | cytoplasm | CC |
| GO:0003676 | nucleic acid binding | MF |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.