General information for g16419.t11
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Glutathione S-transferase.
Parent gene
- The parent gene g16419 is located on chr_4: 9395242..9398308 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16419 | g16419.t11 | TTS | g16419.t11 | 9392821 | 9392821 |
| chr_4 | g16419 | g16419.t11 | isoform | g16419.t11 | 9392882 | 9394301 |
| chr_4 | g16419 | g16419.t11 | exon | g16419.t11.exon1 | 9392882 | 9392934 |
| chr_4 | g16419 | g16419.t11 | cds | g16419.t11.CDS1 | 9392882 | 9392934 |
| chr_4 | g16419 | g16419.t11 | exon | g16419.t11.exon2 | 9393001 | 9393198 |
| chr_4 | g16419 | g16419.t11 | cds | g16419.t11.CDS2 | 9393001 | 9393198 |
| chr_4 | g16419 | g16419.t11 | exon | g16419.t11.exon3 | 9394140 | 9394301 |
| chr_4 | g16419 | g16419.t11 | cds | g16419.t11.CDS3 | 9394140 | 9394248 |
| chr_4 | g16419 | g16419.t11 | TSS | g16419.t11 | NA | NA |
Sequences
>g16419.t11 Gene=g16419 Length=413
CTCTTGGTCAATTACCAGTCTTAGAAATAGACGACAAAGAGCATGTTCAATCAATGGCAA
TTTGTCGCTATTTAGCAAAACAAGTCGGTCTTGCTGGAGACAGTGACCTTGAAAACATGG
AAATTGATGCGGTTGTTGATACTTTCAATGATATTCGTCTTAAAATTTCAACTGTGATGT
GGGAACAAAATCAGGAAGTAAAAAAAGAGAAACAAAAAATTCTACACGAGCAGCAAATTC
CATTTTATTTTAAGAAGCTTGATGAATATGCCGAAGCCAATAATGGACATTTTGCATGTA
AAAAATTAACTTGGGCTGACTTGTACATCGCATCTTGGTCAAAGTATTTCTCTTATGCCA
CAATTGAAAACATTAAAAAATGGGTTGAAACAAGACCCGACACATTCTGTTGA
>g16419.t11 Gene=g16419 Length=119
MAICRYLAKQVGLAGDSDLENMEIDAVVDTFNDIRLKISTVMWEQNQEVKKEKQKILHEQ
QIPFYFKKLDEYAEANNGHFACKKLTWADLYIASWSKYFSYATIENIKKWVETRPDTFC
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g16419.t11 | CDD | cd03192 | GST_C_Sigma_like | 20 | 93 | 0.000 |
| 5 | g16419.t11 | Gene3D | G3DSA:1.20.1050.10 | - | 12 | 114 | 0.000 |
| 2 | g16419.t11 | PANTHER | PTHR11571:SF234 | GLUTATHIONE S-TRANSFERASE S1 | 1 | 102 | 0.000 |
| 3 | g16419.t11 | PANTHER | PTHR11571 | GLUTATHIONE S-TRANSFERASE | 1 | 102 | 0.000 |
| 1 | g16419.t11 | Pfam | PF14497 | Glutathione S-transferase, C-terminal domain | 32 | 111 | 0.000 |
| 7 | g16419.t11 | ProSiteProfiles | PS50404 | Soluble glutathione S-transferase N-terminal domain profile. | 1 | 15 | 8.434 |
| 6 | g16419.t11 | ProSiteProfiles | PS50405 | Soluble glutathione S-transferase C-terminal domain profile. | 17 | 119 | 11.592 |
| 4 | g16419.t11 | SUPERFAMILY | SSF47616 | GST C-terminal domain-like | 13 | 116 | 0.000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006749 | glutathione metabolic process | BP |
| GO:0005515 | protein binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
