General information for g1656.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Equilibrative nucleoside transporter 1.
Parent gene
- The parent gene g1656 is located on chr_3: 12327932..12328632 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1656 | g1656.t1 | isoform | g1656.t1 | 12324618 | 12327932 |
| chr_3 | g1656 | g1656.t1 | exon | g1656.t1.exon1 | 12324618 | 12324781 |
| chr_3 | g1656 | g1656.t1 | cds | g1656.t1.CDS1 | 12324618 | 12324781 |
| chr_3 | g1656 | g1656.t1 | exon | g1656.t1.exon2 | 12326753 | 12326898 |
| chr_3 | g1656 | g1656.t1 | cds | g1656.t1.CDS2 | 12326753 | 12326898 |
| chr_3 | g1656 | g1656.t1 | exon | g1656.t1.exon3 | 12326981 | 12327522 |
| chr_3 | g1656 | g1656.t1 | cds | g1656.t1.CDS3 | 12326981 | 12327522 |
| chr_3 | g1656 | g1656.t1 | exon | g1656.t1.exon4 | 12327597 | 12327932 |
| chr_3 | g1656 | g1656.t1 | cds | g1656.t1.CDS4 | 12327597 | 12327932 |
| chr_3 | g1656 | g1656.t1 | TTS | g1656.t1 | 12328629 | 12328629 |
| chr_3 | g1656 | g1656.t1 | TSS | g1656.t1 | NA | NA |
Sequences
>g1656.t1 Gene=g1656 Length=1188
ATGTTCATCACTGCAAAAGACTATTTTATTAATTATAAACTTTCACCAAACTACACCGGT
ACAAATAACACCGAGTATGCTGAAAATTTCATGCCATATCTTACTTTTGCTTCACAAATT
CCTAATGTTTTGTTCAATTGGATGAATGTATTTGTTAATTTAGGAGGTGACCTAACAAAA
CGTGTAGTATGGAGCTTGATAATTGAAATTCTCATCTTTCTCGTCACCGTTATTTTGGCG
ATGATTGACTCATCAGCATGGCCAAGTGAATTTTTTTGGATAACCATGTCAAGTGTTGTT
GTTCTAAATATGTTTGGAGGCATCTTTCAAAATACGGTTTATGGTATGGCAGCAAAATTA
CCTCCTAAATATACTGGCGCAGTTGTGTTAGGATCAAATATTAGCGGTACATTTGCAACA
ATCATTAGCATTCTCAGTGGATCAATTTGGTCATCATACCGAAAAGCCGCAATTTATTAC
TTTATTACCGCAATGTTTGTTATACTCTTATGTTTTGACACGTATTTTGCTATGCCTTTA
AACAAGTTCTTTCGTTATCATGAAATGAAAAGTGAAAAGGAACAAGAGAAACGACCAGGA
CAAATTGTTGCAAATGCTCGTCCTCCATATTGGACAATTTTCAAAAAATCTTTTCCACAA
CTCTTCAATGTCTTCATAATTTTCTTTGTAACACTCTCGGTGTTTCCAACTGTACATTCA
GATATTAAATCCATAAGTAATGAACCGTTTTTTGGATTTGTTCCTGTAAAAATGTTCACT
CCAATCACATGCTTTTTAACGTTCAACGTTTTTGCTATGCTTGGTAGTTTAACAACATCA
TGGATTCAATGGCCTTCACCAAAATATCTCGTATGGCCAGTGCTTTTACGTCTGTTATTC
ATCCCACTCTTTCTTTTCTGCAACTATCATCCGTTAAATGTGGAACGAAAGCTCCCAGTG
TACATTAATAATGACTATCTTTATTGGATTATTGCTGTACTTATGAGCTATTCCTCTGGT
TATTTGAGCTCACTTGCTATGATGTATGCGCCGCGTGCACAAACAAATACTTTGCATCAA
ATTAAAGCCGGTATGATGGCGGCAGCAATGCTTATTTCTGGTATTTTCGCTGGTATCATG
TTTTCATTTATGGCTCCAATTTTCGTTCAACTACAAATGCCTTTGTGA
>g1656.t1 Gene=g1656 Length=395
MFITAKDYFINYKLSPNYTGTNNTEYAENFMPYLTFASQIPNVLFNWMNVFVNLGGDLTK
RVVWSLIIEILIFLVTVILAMIDSSAWPSEFFWITMSSVVVLNMFGGIFQNTVYGMAAKL
PPKYTGAVVLGSNISGTFATIISILSGSIWSSYRKAAIYYFITAMFVILLCFDTYFAMPL
NKFFRYHEMKSEKEQEKRPGQIVANARPPYWTIFKKSFPQLFNVFIIFFVTLSVFPTVHS
DIKSISNEPFFGFVPVKMFTPITCFLTFNVFAMLGSLTTSWIQWPSPKYLVWPVLLRLLF
IPLFLFCNYHPLNVERKLPVYINNDYLYWIIAVLMSYSSGYLSSLAMMYAPRAQTNTLHQ
IKAGMMAAAMLISGIFAGIMFSFMAPIFVQLQMPL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g1656.t1 | PANTHER | PTHR10332 | EQUILIBRATIVE NUCLEOSIDE TRANSPORTER | 1 | 391 | 2.2E-155 |
| 3 | g1656.t1 | PANTHER | PTHR10332:SF80 | EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 2, ISOFORM A | 1 | 391 | 2.2E-155 |
| 41 | g1656.t1 | PIRSF | PIRSF016379 | ENT | 1 | 390 | 2.8E-59 |
| 4 | g1656.t1 | PRINTS | PR01130 | Delayed-early response protein/equilibrative nucleoside transporter signature | 102 | 124 | 1.2E-12 |
| 6 | g1656.t1 | PRINTS | PR01130 | Delayed-early response protein/equilibrative nucleoside transporter signature | 130 | 150 | 1.2E-12 |
| 8 | g1656.t1 | PRINTS | PR01130 | Delayed-early response protein/equilibrative nucleoside transporter signature | 156 | 179 | 1.2E-12 |
| 7 | g1656.t1 | PRINTS | PR01130 | Delayed-early response protein/equilibrative nucleoside transporter signature | 252 | 269 | 1.2E-12 |
| 5 | g1656.t1 | PRINTS | PR01130 | Delayed-early response protein/equilibrative nucleoside transporter signature | 377 | 395 | 1.2E-12 |
| 1 | g1656.t1 | Pfam | PF01733 | Nucleoside transporter | 96 | 384 | 1.1E-62 |
| 30 | g1656.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 29 | - |
| 33 | g1656.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 30 | 50 | - |
| 23 | g1656.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 51 | 61 | - |
| 36 | g1656.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 62 | 82 | - |
| 27 | g1656.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 83 | 93 | - |
| 37 | g1656.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 94 | 114 | - |
| 24 | g1656.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 115 | 125 | - |
| 34 | g1656.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 126 | 151 | - |
| 26 | g1656.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 152 | 156 | - |
| 39 | g1656.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 157 | 180 | - |
| 21 | g1656.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 181 | 220 | - |
| 38 | g1656.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 221 | 238 | - |
| 29 | g1656.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 239 | 257 | - |
| 35 | g1656.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 258 | 277 | - |
| 22 | g1656.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 278 | 288 | - |
| 32 | g1656.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 289 | 306 | - |
| 28 | g1656.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 307 | 325 | - |
| 40 | g1656.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 326 | 351 | - |
| 20 | g1656.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 352 | 362 | - |
| 31 | g1656.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 363 | 389 | - |
| 25 | g1656.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 390 | 395 | - |
| 19 | g1656.t1 | SUPERFAMILY | SSF103473 | MFS general substrate transporter | 48 | 385 | 1.03E-7 |
| 14 | g1656.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 33 | 55 | - |
| 18 | g1656.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 62 | 81 | - |
| 13 | g1656.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 91 | 113 | - |
| 17 | g1656.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 126 | 148 | - |
| 11 | g1656.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 158 | 180 | - |
| 16 | g1656.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 221 | 238 | - |
| 12 | g1656.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 258 | 277 | - |
| 10 | g1656.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 290 | 312 | - |
| 15 | g1656.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 327 | 346 | - |
| 9 | g1656.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 367 | 389 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
## Warning: Removed 1 row(s) containing missing values (geom_path).
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005337 | nucleoside transmembrane transporter activity | MF |
| GO:1901642 | nucleoside transmembrane transport | BP |
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K15014 (solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
