General information for g16610.t7
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g16610 is located on chr_4: 10220610..10225182 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16610 | g16610.t7 | isoform | g16610.t7 | 10217630 | 10220519 |
| chr_4 | g16610 | g16610.t7 | exon | g16610.t7.exon1 | 10217630 | 10217884 |
| chr_4 | g16610 | g16610.t7 | cds | g16610.t7.CDS1 | 10217630 | 10217884 |
| chr_4 | g16610 | g16610.t7 | exon | g16610.t7.exon2 | 10217938 | 10217985 |
| chr_4 | g16610 | g16610.t7 | cds | g16610.t7.CDS2 | 10217938 | 10217985 |
| chr_4 | g16610 | g16610.t7 | exon | g16610.t7.exon3 | 10220362 | 10220519 |
| chr_4 | g16610 | g16610.t7 | cds | g16610.t7.CDS3 | 10220362 | 10220388 |
| chr_4 | g16610 | g16610.t7 | TTS | g16610.t7 | 10221355 | 10221355 |
| chr_4 | g16610 | g16610.t7 | TSS | g16610.t7 | NA | NA |
Sequences
>g16610.t7 Gene=g16610 Length=461
ATGAAGATTTTAATTTTTGCTACTCTAATTTCTTTAGCAAATTGTTGGGTTAATTTGCCA
GATGAAGTAAAAACTGCAAAATCTATGGATGAACATCCAACGATTCAAAAGATTTTAAGA
GAAAAAAATCCAGAGTTGTTCAATGAAAATGGCGAATTTATTAATAAAACTCCATTCATA
GTTGGAGGATCGAATGCAACTTTAGGCCAATTTCCACATCAGGCGTTGCTTTTTACTTAT
GTTGACGCTAAATCTATTTATCTTTGTGGTGGCTCTTTGATTCGTTATAATTGGGTTTTG
ACACACATTGTGTCTATATTCCTTACATAAAAGTAGCAGTATATCTTGGAATCATTGATT
CTTATAATGGACCTGCACAATGGGGCGCAGATGTGACTTCAAAATCAGATGTAAAAATCC
ATTCAAGTTACAATGACGAATTCCTTATCAACGATATTGCC
>g16610.t7 Gene=g16610 Length=109
MKILIFATLISLANCWVNLPDEVKTAKSMDEHPTIQKILREKNPELFNENGEFINKTPFI
VGGSNATLGQFPHQALLFTYVDAKSIYLCGGSLIRYNWVLTHIVSIFLT
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g16610.t7 | Gene3D | G3DSA:2.40.10.10 | - | 60 | 102 | 1.5E-10 |
| 1 | g16610.t7 | Pfam | PF00089 | Trypsin | 60 | 101 | 5.6E-6 |
| 6 | g16610.t7 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 15 | - |
| 7 | g16610.t7 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 2 | - |
| 8 | g16610.t7 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 3 | 10 | - |
| 9 | g16610.t7 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 11 | 15 | - |
| 5 | g16610.t7 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 16 | 109 | - |
| 2 | g16610.t7 | SUPERFAMILY | SSF50494 | Trypsin-like serine proteases | 53 | 101 | 2.28E-13 |
| 3 | g16610.t7 | SignalP_EUK | SignalP-noTM | SignalP-noTM | 1 | 15 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0004252 | serine-type endopeptidase activity | MF |
| GO:0006508 | proteolysis | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed