| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16628 | g16628.t1 | isoform | g16628.t1 | 10316433 | 10316837 |
| chr_4 | g16628 | g16628.t1 | exon | g16628.t1.exon1 | 10316433 | 10316499 |
| chr_4 | g16628 | g16628.t1 | cds | g16628.t1.CDS1 | 10316433 | 10316499 |
| chr_4 | g16628 | g16628.t1 | exon | g16628.t1.exon2 | 10316674 | 10316837 |
| chr_4 | g16628 | g16628.t1 | cds | g16628.t1.CDS2 | 10316674 | 10316837 |
| chr_4 | g16628 | g16628.t1 | TTS | g16628.t1 | 10316818 | 10316818 |
| chr_4 | g16628 | g16628.t1 | TSS | g16628.t1 | NA | NA |
>g16628.t1 Gene=g16628 Length=231
ATGGATGTAATTCGACTTTTAAATAATGAAGACTTTTTAATGAGACATAAAAAAGAAGTT
CATAATCCAAAACCACAAGAGGAAAAGAGATGTGAATTTTGCAGCTACATAGCAAAGAAT
GCTAAAAATTACTTTCAACATATGAGAAGAACTCACAATATTAAGAAAAGAATCAACAAC
AGAGTTTTTCCATTAACTGCAATTAATTTAACAAAAAAGAAAAAGGAATAA
>g16628.t1 Gene=g16628 Length=76
MDVIRLLNNEDFLMRHKKEVHNPKPQEEKRCEFCSYIAKNAKNYFQHMRRTHNIKKRINN
RVFPLTAINLTKKKKE
| Transcript | Database | ID | Name | Start | End | E.value |
|---|---|---|---|---|---|---|
| g16628.t1 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 6 | 75 | 4.1e-05 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed