General information for g16629.t30
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g16629 is located on chr_4: 10318323..10318846 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16629 | g16629.t30 | TSS | g16629.t30 | 10317513 | 10317513 |
| chr_4 | g16629 | g16629.t30 | isoform | g16629.t30 | 10318028 | 10318846 |
| chr_4 | g16629 | g16629.t30 | exon | g16629.t30.exon1 | 10318028 | 10318173 |
| chr_4 | g16629 | g16629.t30 | exon | g16629.t30.exon2 | 10318322 | 10318476 |
| chr_4 | g16629 | g16629.t30 | cds | g16629.t30.CDS1 | 10318443 | 10318476 |
| chr_4 | g16629 | g16629.t30 | exon | g16629.t30.exon3 | 10318537 | 10318557 |
| chr_4 | g16629 | g16629.t30 | cds | g16629.t30.CDS2 | 10318537 | 10318557 |
| chr_4 | g16629 | g16629.t30 | exon | g16629.t30.exon4 | 10318620 | 10318697 |
| chr_4 | g16629 | g16629.t30 | cds | g16629.t30.CDS3 | 10318620 | 10318697 |
| chr_4 | g16629 | g16629.t30 | exon | g16629.t30.exon5 | 10318791 | 10318846 |
| chr_4 | g16629 | g16629.t30 | cds | g16629.t30.CDS4 | 10318791 | 10318846 |
| chr_4 | g16629 | g16629.t30 | TTS | g16629.t30 | 10319022 | 10319022 |
Sequences
>g16629.t30 Gene=g16629 Length=456
GCTAAAAGTATTAAAATTAATCCACAATATAACTCAAAAACTCATGATTATGATTCGGGT
GTTATTGAAATTGGTGGTACTTTTAGTGCTAACCCAGTACAGCTTGCAACTGTTTTGCCA
TCGAGTGGAAGCAGTGTCACAGCAATTGGTTGGGGTGAATTAATAGAAAATGGTCCTTTA
CCTTTTAAATTACAAGCAGTTGGACTAAATTTGATATCACAAGATCAATGTTCAAGATAT
TATCGTTCACATACATTTACTGCTAGAATGATTTGTGCAGGAGTTAACGGTGGAGGAAAA
GATACATGCCAAGGCGATTCAGGTGGTCCACTTATTTCTAATGGAAATTTAATCGGCATC
ACATCTTTTGGTATTGGTTGTGCTCGAGCAAATTATCCAGGTGTCTACTCAAATGTGCCA
AGTTTATATAAATGGATCAACGATGCAACACCATAA
>g16629.t30 Gene=g16629 Length=62
MICAGVNGGGKDTCQGDSGGPLISNGNLIGITSFGIGCARANYPGVYSNVPSLYKWINDA
TP
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g16629.t30 | Gene3D | G3DSA:2.40.10.10 | - | 1 | 51 | 2.2E-24 |
| 2 | g16629.t30 | PANTHER | PTHR24276 | POLYSERASE-RELATED | 1 | 59 | 2.8E-24 |
| 3 | g16629.t30 | PANTHER | PTHR24276:SF83 | GH13245P2-RELATED | 1 | 59 | 2.8E-24 |
| 1 | g16629.t30 | Pfam | PF00089 | Trypsin | 1 | 57 | 5.1E-21 |
| 5 | g16629.t30 | ProSitePatterns | PS00135 | Serine proteases, trypsin family, serine active site. | 12 | 23 | - |
| 7 | g16629.t30 | ProSiteProfiles | PS50240 | Serine proteases, trypsin domain profile. | 1 | 62 | 14.116 |
| 4 | g16629.t30 | SUPERFAMILY | SSF50494 | Trypsin-like serine proteases | 1 | 61 | 1.66E-24 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0004252 | serine-type endopeptidase activity | MF |
| GO:0006508 | proteolysis | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed