Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_4 g16629 g16629.t31 TSS g16629.t31 10317513 10317513
chr_4 g16629 g16629.t31 isoform g16629.t31 10318323 10318846
chr_4 g16629 g16629.t31 exon g16629.t31.exon1 10318323 10318476
chr_4 g16629 g16629.t31 cds g16629.t31.CDS1 10318443 10318476
chr_4 g16629 g16629.t31 exon g16629.t31.exon2 10318537 10318557
chr_4 g16629 g16629.t31 cds g16629.t31.CDS2 10318537 10318557
chr_4 g16629 g16629.t31 exon g16629.t31.exon3 10318620 10318697
chr_4 g16629 g16629.t31 cds g16629.t31.CDS3 10318620 10318697
chr_4 g16629 g16629.t31 exon g16629.t31.exon4 10318791 10318846
chr_4 g16629 g16629.t31 cds g16629.t31.CDS4 10318791 10318846
chr_4 g16629 g16629.t31 TTS g16629.t31 10319022 10319022

Sequences

>g16629.t31 Gene=g16629 Length=309
GGTTGGGGTGAATTAATAGAAAATGGTCCTTTACCTTTTAAATTACAAGCAGTTGGACTA
AATTTGATATCACAAGATCAATGTTCAAGATATTATCGTTCACATACATTTACTGCTAGA
ATGATTTGTGCAGGAGTTAACGGTGGAGGAAAAGATACATGCCAAGGCGATTCAGGTGGT
CCACTTATTTCTAATGGAAATTTAATCGGCATCACATCTTTTGGTATTGGTTGTGCTCGA
GCAAATTATCCAGGTGTCTACTCAAATGTGCCAAGTTTATATAAATGGATCAACGATGCA
ACACCATAA

>g16629.t31 Gene=g16629 Length=62
MICAGVNGGGKDTCQGDSGGPLISNGNLIGITSFGIGCARANYPGVYSNVPSLYKWINDA
TP

Protein features from InterProScan

Transcript Database ID Name Start End E.value
6 g16629.t31 Gene3D G3DSA:2.40.10.10 - 1 51 2.2E-24
2 g16629.t31 PANTHER PTHR24276 POLYSERASE-RELATED 1 59 2.8E-24
3 g16629.t31 PANTHER PTHR24276:SF83 GH13245P2-RELATED 1 59 2.8E-24
1 g16629.t31 Pfam PF00089 Trypsin 1 57 5.1E-21
5 g16629.t31 ProSitePatterns PS00135 Serine proteases, trypsin family, serine active site. 12 23 -
7 g16629.t31 ProSiteProfiles PS50240 Serine proteases, trypsin domain profile. 1 62 14.116
4 g16629.t31 SUPERFAMILY SSF50494 Trypsin-like serine proteases 1 61 1.66E-24

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0004252 serine-type endopeptidase activity MF
GO:0006508 proteolysis BP

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed