| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16841 | g16841.t5 | TTS | g16841.t5 | 11365394 | 11365394 |
| chr_4 | g16841 | g16841.t5 | isoform | g16841.t5 | 11365453 | 11366002 |
| chr_4 | g16841 | g16841.t5 | exon | g16841.t5.exon1 | 11365453 | 11365560 |
| chr_4 | g16841 | g16841.t5 | cds | g16841.t5.CDS1 | 11365454 | 11365560 |
| chr_4 | g16841 | g16841.t5 | exon | g16841.t5.exon2 | 11365691 | 11365763 |
| chr_4 | g16841 | g16841.t5 | cds | g16841.t5.CDS2 | 11365691 | 11365763 |
| chr_4 | g16841 | g16841.t5 | exon | g16841.t5.exon3 | 11365865 | 11366002 |
| chr_4 | g16841 | g16841.t5 | cds | g16841.t5.CDS3 | 11365865 | 11366002 |
| chr_4 | g16841 | g16841.t5 | TSS | g16841.t5 | 11366146 | 11366146 |
>g16841.t5 Gene=g16841 Length=319
ATGGATGAAGAAGATAAAATTTCTGATAGCGAAAATCAAACAAAACCAGAAAAAATGTTT
ACATTAAAAAGATGGAATAGTGTGGCTATGTGGTCATGGGATTGTTCAACAGATACTTGT
GCTATATGTCGAGTTCAAGTCATGGATGCATGTTTAAGATGTCAAGCAGAATCTAAAAAA
GATGCTACTAATAAAGATGTTACTTGTGTTGTTATTTTAATACTTACATTTTCAATATTT
ATTCAGTTTATGGGTGAAACAATCAAACAGATGTCCATTATGTCAACAAGAATGGAGTAT
TCAACGACTGTCAAGTTAA
>g16841.t5 Gene=g16841 Length=106
MDEEDKISDSENQTKPEKMFTLKRWNSVAMWSWDCSTDTCAICRVQVMDACLRCQAESKK
DATNKDVTCVVILILTFSIFIQFMGETIKQMSIMSTRMEYSTTVKL
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g16841.t5 | Gene3D | G3DSA:3.30.40.10 | Zinc/RING finger domain | 7 | 75 | 2.9E-11 |
| 2 | g16841.t5 | PANTHER | PTHR11210 | RING BOX | 6 | 93 | 2.2E-24 |
| 3 | g16841.t5 | PANTHER | PTHR11210:SF27 | RING-BOX PROTEIN 2 | 6 | 93 | 2.2E-24 |
| 1 | g16841.t5 | Pfam | PF12861 | Anaphase-promoting complex subunit 11 RING-H2 finger | 21 | 57 | 5.5E-6 |
| 7 | g16841.t5 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 66 | - |
| 9 | g16841.t5 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 67 | 85 | - |
| 8 | g16841.t5 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 86 | 106 | - |
| 5 | g16841.t5 | SUPERFAMILY | SSF57850 | RING/U-box | 18 | 64 | 2.3E-13 |
| 4 | g16841.t5 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 67 | 84 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0061630 | ubiquitin protein ligase activity | MF |
| GO:0031145 | anaphase-promoting complex-dependent catabolic process | BP |
| GO:0008270 | zinc ion binding | MF |
| GO:0097602 | cullin family protein binding | MF |
| GO:0005680 | anaphase-promoting complex | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed