Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_4 g16841 g16841.t5 TTS g16841.t5 11365394 11365394
chr_4 g16841 g16841.t5 isoform g16841.t5 11365453 11366002
chr_4 g16841 g16841.t5 exon g16841.t5.exon1 11365453 11365560
chr_4 g16841 g16841.t5 cds g16841.t5.CDS1 11365454 11365560
chr_4 g16841 g16841.t5 exon g16841.t5.exon2 11365691 11365763
chr_4 g16841 g16841.t5 cds g16841.t5.CDS2 11365691 11365763
chr_4 g16841 g16841.t5 exon g16841.t5.exon3 11365865 11366002
chr_4 g16841 g16841.t5 cds g16841.t5.CDS3 11365865 11366002
chr_4 g16841 g16841.t5 TSS g16841.t5 11366146 11366146

Sequences

>g16841.t5 Gene=g16841 Length=319
ATGGATGAAGAAGATAAAATTTCTGATAGCGAAAATCAAACAAAACCAGAAAAAATGTTT
ACATTAAAAAGATGGAATAGTGTGGCTATGTGGTCATGGGATTGTTCAACAGATACTTGT
GCTATATGTCGAGTTCAAGTCATGGATGCATGTTTAAGATGTCAAGCAGAATCTAAAAAA
GATGCTACTAATAAAGATGTTACTTGTGTTGTTATTTTAATACTTACATTTTCAATATTT
ATTCAGTTTATGGGTGAAACAATCAAACAGATGTCCATTATGTCAACAAGAATGGAGTAT
TCAACGACTGTCAAGTTAA

>g16841.t5 Gene=g16841 Length=106
MDEEDKISDSENQTKPEKMFTLKRWNSVAMWSWDCSTDTCAICRVQVMDACLRCQAESKK
DATNKDVTCVVILILTFSIFIQFMGETIKQMSIMSTRMEYSTTVKL

Protein features from InterProScan

Transcript Database ID Name Start End E.value
6 g16841.t5 Gene3D G3DSA:3.30.40.10 Zinc/RING finger domain 7 75 2.9E-11
2 g16841.t5 PANTHER PTHR11210 RING BOX 6 93 2.2E-24
3 g16841.t5 PANTHER PTHR11210:SF27 RING-BOX PROTEIN 2 6 93 2.2E-24
1 g16841.t5 Pfam PF12861 Anaphase-promoting complex subunit 11 RING-H2 finger 21 57 5.5E-6
7 g16841.t5 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 1 66 -
9 g16841.t5 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 67 85 -
8 g16841.t5 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 86 106 -
5 g16841.t5 SUPERFAMILY SSF57850 RING/U-box 18 64 2.3E-13
4 g16841.t5 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 67 84 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0061630 ubiquitin protein ligase activity MF
GO:0031145 anaphase-promoting complex-dependent catabolic process BP
GO:0008270 zinc ion binding MF
GO:0097602 cullin family protein binding MF
GO:0005680 anaphase-promoting complex CC

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed