Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_4 g16927 g16927.t1 isoform g16927.t1 11754762 11756911
chr_4 g16927 g16927.t1 exon g16927.t1.exon1 11754762 11754944
chr_4 g16927 g16927.t1 cds g16927.t1.CDS1 11754762 11754944
chr_4 g16927 g16927.t1 exon g16927.t1.exon2 11755244 11755375
chr_4 g16927 g16927.t1 cds g16927.t1.CDS2 11755244 11755375
chr_4 g16927 g16927.t1 exon g16927.t1.exon3 11755871 11756073
chr_4 g16927 g16927.t1 cds g16927.t1.CDS3 11755871 11756073
chr_4 g16927 g16927.t1 exon g16927.t1.exon4 11756129 11756183
chr_4 g16927 g16927.t1 cds g16927.t1.CDS4 11756129 11756183
chr_4 g16927 g16927.t1 exon g16927.t1.exon5 11756417 11756533
chr_4 g16927 g16927.t1 cds g16927.t1.CDS5 11756417 11756533
chr_4 g16927 g16927.t1 exon g16927.t1.exon6 11756696 11756911
chr_4 g16927 g16927.t1 cds g16927.t1.CDS6 11756696 11756911
chr_4 g16927 g16927.t1 TSS g16927.t1 NA NA
chr_4 g16927 g16927.t1 TTS g16927.t1 NA NA

Sequences

>g16927.t1 Gene=g16927 Length=906
ATGACACAAAATTTCATAAAAGAAATAAAAAATGAAGACAAAATTTACACAATAATTGAA
ATTATAGTCTCAATTTTTGCTGTGTTTTCAAATTCTTTGGTTATCAGTGCATTTTTTATT
GAAAGAAATTTAAAAACAAGAATTCATAAATTTATTCTTTCACTTTCAATTATTGACTTA
ATTGCTGGAATCATTGCCATTCCTGCTGCTACATTTTTCGACGATGAACTTTTTAAAGGA
CGACTAATTTGTCTTTCAATTATATCAACTTATATAATTTTGGTCACAATTTCAAAATGG
ATTGTTGTTGCTATTGCAGTTAATTGTTTTTGGGCAATTGTTTATCCACTACATTATTTT
GCATACAATGAAAAAGTTCCTGTTAAAGTTCCAATAGGATTAAGCTGCATAATTGGATTG
ATTATTGGAATTTTACCAGTCGCTGGCTGGAATAGAAAAGATAGCGATGAATGCAAATTT
TTTAGCATCATTTCACAAACTTATATTTATTTTTATTATTCAACAGCTTCATTAATTCCA
TCAGCAATTTTAATTATTCTTTATGGATTAGTTATTTATGAAATTCATAAGTCAAAATCG
AGAAGAACGAATAGAAATTCAGATGATACAACAATAATTCGAGTAAATTCAAATTCATCA
AGTGAAATTTCAGCAATTAGCAAACTCATGAGTGTCGTTTTAATTTTCATTATTTGTTGG
ACTCCAATCAATTTCATAAATCTGGCAAAAACTGTTAGCCCATCATTTGAAGTTTATCGA
CCAATGCAACAAACTTCTGTAATCATTGCTCACATTGGTCTTTCAATGAATCCAATTTTA
TATTCTTATCGTTTAAAAGAAATTCGCAATGCAATCATTAAAATATTTTCAAAGAGACAA
AATTAA

>g16927.t1 Gene=g16927 Length=301
MTQNFIKEIKNEDKIYTIIEIIVSIFAVFSNSLVISAFFIERNLKTRIHKFILSLSIIDL
IAGIIAIPAATFFDDELFKGRLICLSIISTYIILVTISKWIVVAIAVNCFWAIVYPLHYF
AYNEKVPVKVPIGLSCIIGLIIGILPVAGWNRKDSDECKFFSIISQTYIYFYYSTASLIP
SAILIILYGLVIYEIHKSKSRRTNRNSDDTTIIRVNSNSSSEISAISKLMSVVLIFIICW
TPINFINLAKTVSPSFEVYRPMQQTSVIIAHIGLSMNPILYSYRLKEIRNAIIKIFSKRQ
N

Protein features from InterProScan

Transcript Database ID Name Start End E.value
11 g16927.t1 Gene3D G3DSA:1.20.1070.10 - 2 301 2.4E-48
2 g16927.t1 PANTHER PTHR24246:SF21 ADENOSINE RECEPTOR A2C 15 297 7.5E-36
3 g16927.t1 PANTHER PTHR24246 OLFACTORY RECEPTOR AND ADENOSINE RECEPTOR 15 297 7.5E-36
5 g16927.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 15 39 5.2E-21
7 g16927.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 48 69 5.2E-21
9 g16927.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 91 113 5.2E-21
4 g16927.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 169 192 5.2E-21
8 g16927.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 225 249 5.2E-21
6 g16927.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 263 289 5.2E-21
1 g16927.t1 Pfam PF00001 7 transmembrane receptor (rhodopsin family) 31 281 2.5E-33
19 g16927.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 1 14 -
20 g16927.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 15 39 -
14 g16927.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 40 50 -
26 g16927.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 51 73 -
18 g16927.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 74 84 -
22 g16927.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 85 114 -
13 g16927.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 115 125 -
24 g16927.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 126 150 -
16 g16927.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 151 169 -
21 g16927.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 170 193 -
15 g16927.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 194 228 -
23 g16927.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 229 246 -
17 g16927.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 247 265 -
25 g16927.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 266 283 -
12 g16927.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 284 301 -
35 g16927.t1 ProSiteProfiles PS50262 G-protein coupled receptors family 1 profile. 30 281 29.319
34 g16927.t1 SMART SM01381 7TM_GPCR_Srsx_2 24 296 2.2E-5
10 g16927.t1 SUPERFAMILY SSF81321 Family A G protein-coupled receptor-like 14 299 4.39E-46
27 g16927.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 15 39 -
30 g16927.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 51 73 -
28 g16927.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 93 115 -
29 g16927.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 128 150 -
33 g16927.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 170 192 -
32 g16927.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 224 246 -
31 g16927.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 261 283 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0007186 G protein-coupled receptor signaling pathway BP
GO:0016021 integral component of membrane CC
GO:0004930 G protein-coupled receptor activity MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed