| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16927 | g16927.t1 | isoform | g16927.t1 | 11754762 | 11756911 |
| chr_4 | g16927 | g16927.t1 | exon | g16927.t1.exon1 | 11754762 | 11754944 |
| chr_4 | g16927 | g16927.t1 | cds | g16927.t1.CDS1 | 11754762 | 11754944 |
| chr_4 | g16927 | g16927.t1 | exon | g16927.t1.exon2 | 11755244 | 11755375 |
| chr_4 | g16927 | g16927.t1 | cds | g16927.t1.CDS2 | 11755244 | 11755375 |
| chr_4 | g16927 | g16927.t1 | exon | g16927.t1.exon3 | 11755871 | 11756073 |
| chr_4 | g16927 | g16927.t1 | cds | g16927.t1.CDS3 | 11755871 | 11756073 |
| chr_4 | g16927 | g16927.t1 | exon | g16927.t1.exon4 | 11756129 | 11756183 |
| chr_4 | g16927 | g16927.t1 | cds | g16927.t1.CDS4 | 11756129 | 11756183 |
| chr_4 | g16927 | g16927.t1 | exon | g16927.t1.exon5 | 11756417 | 11756533 |
| chr_4 | g16927 | g16927.t1 | cds | g16927.t1.CDS5 | 11756417 | 11756533 |
| chr_4 | g16927 | g16927.t1 | exon | g16927.t1.exon6 | 11756696 | 11756911 |
| chr_4 | g16927 | g16927.t1 | cds | g16927.t1.CDS6 | 11756696 | 11756911 |
| chr_4 | g16927 | g16927.t1 | TSS | g16927.t1 | NA | NA |
| chr_4 | g16927 | g16927.t1 | TTS | g16927.t1 | NA | NA |
>g16927.t1 Gene=g16927 Length=906
ATGACACAAAATTTCATAAAAGAAATAAAAAATGAAGACAAAATTTACACAATAATTGAA
ATTATAGTCTCAATTTTTGCTGTGTTTTCAAATTCTTTGGTTATCAGTGCATTTTTTATT
GAAAGAAATTTAAAAACAAGAATTCATAAATTTATTCTTTCACTTTCAATTATTGACTTA
ATTGCTGGAATCATTGCCATTCCTGCTGCTACATTTTTCGACGATGAACTTTTTAAAGGA
CGACTAATTTGTCTTTCAATTATATCAACTTATATAATTTTGGTCACAATTTCAAAATGG
ATTGTTGTTGCTATTGCAGTTAATTGTTTTTGGGCAATTGTTTATCCACTACATTATTTT
GCATACAATGAAAAAGTTCCTGTTAAAGTTCCAATAGGATTAAGCTGCATAATTGGATTG
ATTATTGGAATTTTACCAGTCGCTGGCTGGAATAGAAAAGATAGCGATGAATGCAAATTT
TTTAGCATCATTTCACAAACTTATATTTATTTTTATTATTCAACAGCTTCATTAATTCCA
TCAGCAATTTTAATTATTCTTTATGGATTAGTTATTTATGAAATTCATAAGTCAAAATCG
AGAAGAACGAATAGAAATTCAGATGATACAACAATAATTCGAGTAAATTCAAATTCATCA
AGTGAAATTTCAGCAATTAGCAAACTCATGAGTGTCGTTTTAATTTTCATTATTTGTTGG
ACTCCAATCAATTTCATAAATCTGGCAAAAACTGTTAGCCCATCATTTGAAGTTTATCGA
CCAATGCAACAAACTTCTGTAATCATTGCTCACATTGGTCTTTCAATGAATCCAATTTTA
TATTCTTATCGTTTAAAAGAAATTCGCAATGCAATCATTAAAATATTTTCAAAGAGACAA
AATTAA
>g16927.t1 Gene=g16927 Length=301
MTQNFIKEIKNEDKIYTIIEIIVSIFAVFSNSLVISAFFIERNLKTRIHKFILSLSIIDL
IAGIIAIPAATFFDDELFKGRLICLSIISTYIILVTISKWIVVAIAVNCFWAIVYPLHYF
AYNEKVPVKVPIGLSCIIGLIIGILPVAGWNRKDSDECKFFSIISQTYIYFYYSTASLIP
SAILIILYGLVIYEIHKSKSRRTNRNSDDTTIIRVNSNSSSEISAISKLMSVVLIFIICW
TPINFINLAKTVSPSFEVYRPMQQTSVIIAHIGLSMNPILYSYRLKEIRNAIIKIFSKRQ
N
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 11 | g16927.t1 | Gene3D | G3DSA:1.20.1070.10 | - | 2 | 301 | 2.4E-48 |
| 2 | g16927.t1 | PANTHER | PTHR24246:SF21 | ADENOSINE RECEPTOR A2C | 15 | 297 | 7.5E-36 |
| 3 | g16927.t1 | PANTHER | PTHR24246 | OLFACTORY RECEPTOR AND ADENOSINE RECEPTOR | 15 | 297 | 7.5E-36 |
| 5 | g16927.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 15 | 39 | 5.2E-21 |
| 7 | g16927.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 48 | 69 | 5.2E-21 |
| 9 | g16927.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 91 | 113 | 5.2E-21 |
| 4 | g16927.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 169 | 192 | 5.2E-21 |
| 8 | g16927.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 225 | 249 | 5.2E-21 |
| 6 | g16927.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 263 | 289 | 5.2E-21 |
| 1 | g16927.t1 | Pfam | PF00001 | 7 transmembrane receptor (rhodopsin family) | 31 | 281 | 2.5E-33 |
| 19 | g16927.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 14 | - |
| 20 | g16927.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 15 | 39 | - |
| 14 | g16927.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 40 | 50 | - |
| 26 | g16927.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 51 | 73 | - |
| 18 | g16927.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 74 | 84 | - |
| 22 | g16927.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 85 | 114 | - |
| 13 | g16927.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 115 | 125 | - |
| 24 | g16927.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 126 | 150 | - |
| 16 | g16927.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 151 | 169 | - |
| 21 | g16927.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 170 | 193 | - |
| 15 | g16927.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 194 | 228 | - |
| 23 | g16927.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 229 | 246 | - |
| 17 | g16927.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 247 | 265 | - |
| 25 | g16927.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 266 | 283 | - |
| 12 | g16927.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 284 | 301 | - |
| 35 | g16927.t1 | ProSiteProfiles | PS50262 | G-protein coupled receptors family 1 profile. | 30 | 281 | 29.319 |
| 34 | g16927.t1 | SMART | SM01381 | 7TM_GPCR_Srsx_2 | 24 | 296 | 2.2E-5 |
| 10 | g16927.t1 | SUPERFAMILY | SSF81321 | Family A G protein-coupled receptor-like | 14 | 299 | 4.39E-46 |
| 27 | g16927.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 15 | 39 | - |
| 30 | g16927.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 51 | 73 | - |
| 28 | g16927.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 93 | 115 | - |
| 29 | g16927.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 128 | 150 | - |
| 33 | g16927.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 170 | 192 | - |
| 32 | g16927.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 224 | 246 | - |
| 31 | g16927.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 261 | 283 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007186 | G protein-coupled receptor signaling pathway | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0004930 | G protein-coupled receptor activity | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed