General information for g16928.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g16928 is located on chr_4: 11764589..11766724 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16928 | g16928.t1 | isoform | g16928.t1 | 11764589 | 11766724 |
| chr_4 | g16928 | g16928.t1 | exon | g16928.t1.exon1 | 11764589 | 11764735 |
| chr_4 | g16928 | g16928.t1 | cds | g16928.t1.CDS1 | 11764589 | 11764735 |
| chr_4 | g16928 | g16928.t1 | exon | g16928.t1.exon2 | 11765069 | 11765200 |
| chr_4 | g16928 | g16928.t1 | cds | g16928.t1.CDS2 | 11765069 | 11765200 |
| chr_4 | g16928 | g16928.t1 | exon | g16928.t1.exon3 | 11765687 | 11765943 |
| chr_4 | g16928 | g16928.t1 | cds | g16928.t1.CDS3 | 11765687 | 11765943 |
| chr_4 | g16928 | g16928.t1 | exon | g16928.t1.exon4 | 11766189 | 11766333 |
| chr_4 | g16928 | g16928.t1 | cds | g16928.t1.CDS4 | 11766189 | 11766333 |
| chr_4 | g16928 | g16928.t1 | exon | g16928.t1.exon5 | 11766473 | 11766724 |
| chr_4 | g16928 | g16928.t1 | cds | g16928.t1.CDS5 | 11766473 | 11766724 |
| chr_4 | g16928 | g16928.t1 | TSS | g16928.t1 | NA | NA |
| chr_4 | g16928 | g16928.t1 | TTS | g16928.t1 | NA | NA |
Sequences
>g16928.t1 Gene=g16928 Length=933
ATGAATTTTTCTCAACAAAATTTAAATTTTTCAACAATCACACAAAATTTCATAAAAGAA
ATTAAAAATGAAGACAAAATTTACACAATTATTGAAATTATAGTCTTAATTTTTGCTGTG
TTTTCAAATTCTTTGGTTATCAGTGCATTTTTTATTGAAAGAAATTTAAAAACAAGAATT
CATAAATTTATTCTTTCACTTTCAATTATTGACTTAATTGCTGGAATCATTGCTATTCCT
GCTGCTACATTTTTTGATGATGAACTTTTTAAAGGACGACAAATTTGTCTTTCAATTATA
TCAACTTATATAATTTTGGTCACAATTTCAAAATGGATTGTTGTTGCTATTGCAGTTAAT
TGTTTTTGGGTAAATATTATTGAAATATTGAAAAAATGTGACTTAAATTCTTATTTTAAA
TGTCCAAGTAATAACTTTGAAATCACTCCAGTTCCAATAGGATTAAGCTGCATAATTGGA
TTGATTATTGGAATTTTACCAGTCGCTGGCTGGAATAGAAAAGATAGCGATGAATGCAAA
TTTTTTAGCATCATTTCACAAACTTATATTTATTTTTATTATTCAACAGCTTCATTAATT
CCATCAGCAATTTTAATTATTCTTTATGGATTAGTTATTTATGAAATTCATAAGTCAAAA
TCGAGAAGAACGAATAGAAATTCAGATGATACAACAATAATTCGAGTAAATTCAAATTCA
TCAAGTGAAATTTCAGCAATTAGCAAACTCATGAGTGTCGTTTTAATTTTCATTATTTGT
TGGACTCCATCATTTGAAGTTTATCGACCAATGCAACAAACTTCTGTAATCATTGCTCAC
ATTGGTCTTTCAATGAATCCAATTTTATATTCTTATCGTTTAAAAGAAATTCGCAATGCA
ATCATTAAAATATTTTCAAAGAGACAAAATTAA
>g16928.t1 Gene=g16928 Length=310
MNFSQQNLNFSTITQNFIKEIKNEDKIYTIIEIIVLIFAVFSNSLVISAFFIERNLKTRI
HKFILSLSIIDLIAGIIAIPAATFFDDELFKGRQICLSIISTYIILVTISKWIVVAIAVN
CFWVNIIEILKKCDLNSYFKCPSNNFEITPVPIGLSCIIGLIIGILPVAGWNRKDSDECK
FFSIISQTYIYFYYSTASLIPSAILIILYGLVIYEIHKSKSRRTNRNSDDTTIIRVNSNS
SSEISAISKLMSVVLIFIICWTPSFEVYRPMQQTSVIIAHIGLSMNPILYSYRLKEIRNA
IIKIFSKRQN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g16928.t1 | Gene3D | G3DSA:1.20.1070.10 | - | 2 | 308 | 7.3E-36 |
| 2 | g16928.t1 | PANTHER | PTHR24246:SF21 | ADENOSINE RECEPTOR A2C | 27 | 306 | 1.1E-23 |
| 3 | g16928.t1 | PANTHER | PTHR24246 | OLFACTORY RECEPTOR AND ADENOSINE RECEPTOR | 27 | 306 | 1.1E-23 |
| 4 | g16928.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 27 | 51 | 1.9E-12 |
| 6 | g16928.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 60 | 81 | 1.9E-12 |
| 7 | g16928.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 190 | 213 | 1.9E-12 |
| 5 | g16928.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 246 | 270 | 1.9E-12 |
| 1 | g16928.t1 | Pfam | PF00001 | 7 transmembrane receptor (rhodopsin family) | 43 | 268 | 9.2E-20 |
| 16 | g16928.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 26 | - |
| 20 | g16928.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 27 | 51 | - |
| 13 | g16928.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 52 | 62 | - |
| 21 | g16928.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 63 | 83 | - |
| 17 | g16928.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 84 | 102 | - |
| 23 | g16928.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 103 | 127 | - |
| 12 | g16928.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 128 | 147 | - |
| 19 | g16928.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 148 | 171 | - |
| 15 | g16928.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 172 | 190 | - |
| 18 | g16928.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 191 | 214 | - |
| 11 | g16928.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 215 | 249 | - |
| 22 | g16928.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 250 | 268 | - |
| 14 | g16928.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 269 | 273 | - |
| 24 | g16928.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 274 | 292 | - |
| 10 | g16928.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 293 | 310 | - |
| 33 | g16928.t1 | ProSiteProfiles | PS50262 | G-protein coupled receptors family 1 profile. | 42 | 263 | 18.767 |
| 32 | g16928.t1 | SMART | SM01381 | 7TM_GPCR_Srsx_2 | 36 | 305 | 2.3E-4 |
| 8 | g16928.t1 | SUPERFAMILY | SSF81321 | Family A G protein-coupled receptor-like | 17 | 308 | 1.19E-30 |
| 27 | g16928.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 29 | 51 | - |
| 31 | g16928.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 63 | 85 | - |
| 26 | g16928.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 105 | 127 | - |
| 30 | g16928.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 148 | 170 | - |
| 25 | g16928.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 190 | 212 | - |
| 28 | g16928.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 243 | 265 | - |
| 29 | g16928.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 275 | 294 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007186 | G protein-coupled receptor signaling pathway | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0004930 | G protein-coupled receptor activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed