| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g17054 | g17054.t1 | TTS | g17054.t1 | 12324668 | 12324668 |
| chr_4 | g17054 | g17054.t1 | isoform | g17054.t1 | 12324809 | 12325486 |
| chr_4 | g17054 | g17054.t1 | exon | g17054.t1.exon1 | 12324809 | 12325332 |
| chr_4 | g17054 | g17054.t1 | cds | g17054.t1.CDS1 | 12324809 | 12325332 |
| chr_4 | g17054 | g17054.t1 | exon | g17054.t1.exon2 | 12325432 | 12325486 |
| chr_4 | g17054 | g17054.t1 | cds | g17054.t1.CDS2 | 12325432 | 12325486 |
| chr_4 | g17054 | g17054.t1 | TSS | g17054.t1 | 12325634 | 12325634 |
>g17054.t1 Gene=g17054 Length=579
ATGGCAAATCTTATTCGTGCACTTTCACTTCTTGATGATCCATTTTATTCATATGAAACG
GAGCCAAGATTTGGTTTGGGTTTAATTCCAAGTGATTTCTTCTCTGATCGAATTGTTCCA
CGTACTGCATTGCATTATCATTTACCTACTGGCTACTATCGTCCGTGGCAAATGGCTCGT
CAAGCAATGTCTGAATTGAACAAAGATCAAAAGTCATTGCAATTAGGCAAAGAAGGATTC
CAAGCTTGTGTTGATGTTCAACACTTTAAACCAAATGAAATCTCTGTCAAAGTTCAAGAT
CACACTGTCATAATTGAAGGAAAGCATGAAGAACGAGATGATGCACATGGAACCATTGAA
AGAAGTTTTGTTCGCAAATATGTGTTGCCACAAGAATATGACATGAATACAGTTCAATCG
ACTTTGTCAAGTGATGGAGTTTTGACTATCAAGGCACCACCACCACAAGCTATTGATGGA
CCTAAGGAAAGAAATATTGAAATCACTCATACAAATGCACCAGCTCGTGAAAGTATTAAA
GAAAACAAGTCTGAAGAGAAACAAGCCAATCAAAAATAA
>g17054.t1 Gene=g17054 Length=192
MANLIRALSLLDDPFYSYETEPRFGLGLIPSDFFSDRIVPRTALHYHLPTGYYRPWQMAR
QAMSELNKDQKSLQLGKEGFQACVDVQHFKPNEISVKVQDHTVIIEGKHEERDDAHGTIE
RSFVRKYVLPQEYDMNTVQSTLSSDGVLTIKAPPPQAIDGPKERNIEITHTNAPARESIK
ENKSEEKQANQK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 12 | g17054.t1 | CDD | cd06526 | metazoan_ACD | 76 | 153 | 2.95225E-41 |
| 11 | g17054.t1 | Coils | Coil | Coil | 179 | 192 | - |
| 10 | g17054.t1 | Gene3D | G3DSA:2.60.40.790 | - | 53 | 190 | 2.9E-31 |
| 13 | g17054.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 146 | 192 | - |
| 14 | g17054.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 163 | 192 | - |
| 2 | g17054.t1 | PANTHER | PTHR45640:SF23 | HEAT SHOCK PROTEIN 22-RELATED | 56 | 183 | 1.8E-44 |
| 3 | g17054.t1 | PANTHER | PTHR45640 | HEAT SHOCK PROTEIN HSP-12.2-RELATED | 56 | 183 | 1.8E-44 |
| 7 | g17054.t1 | PRINTS | PR00299 | Alpha crystallin signature | 74 | 94 | 1.8E-19 |
| 5 | g17054.t1 | PRINTS | PR00299 | Alpha crystallin signature | 96 | 109 | 1.8E-19 |
| 8 | g17054.t1 | PRINTS | PR00299 | Alpha crystallin signature | 111 | 130 | 1.8E-19 |
| 4 | g17054.t1 | PRINTS | PR00299 | Alpha crystallin signature | 133 | 154 | 1.8E-19 |
| 6 | g17054.t1 | PRINTS | PR00299 | Alpha crystallin signature | 163 | 178 | 1.8E-19 |
| 1 | g17054.t1 | Pfam | PF00011 | Hsp20/alpha crystallin family | 76 | 168 | 1.7E-26 |
| 15 | g17054.t1 | ProSiteProfiles | PS01031 | Small heat shock protein (sHSP) domain profile. | 61 | 169 | 20.771 |
| 9 | g17054.t1 | SUPERFAMILY | SSF49764 | HSP20-like chaperones | 77 | 167 | 2.41E-14 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.