Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Heat shock protein 67B1.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_4 g17055 g17055.t1 TSS g17055.t1 12326778 12326778
chr_4 g17055 g17055.t1 isoform g17055.t1 12326918 12327543
chr_4 g17055 g17055.t1 exon g17055.t1.exon1 12326918 12326966
chr_4 g17055 g17055.t1 cds g17055.t1.CDS1 12326918 12326966
chr_4 g17055 g17055.t1 exon g17055.t1.exon2 12327071 12327543
chr_4 g17055 g17055.t1 cds g17055.t1.CDS2 12327071 12327543
chr_4 g17055 g17055.t1 TTS g17055.t1 12327624 12327624

Sequences

>g17055.t1 Gene=g17055 Length=522
ATGTCAAGCATAGTTCGTGCACTTCTTAGAGATCCATATTTTGCTTATGAATTAAGACCA
AGATTTGGAATGATTCCAAATGACTTTTTCTATCCAATAACATATTATCGTCCATGGCAA
ATGGTTTGTGAAGCTTTCAGTGAATTAAATGAAGATCAAAGTTCAATTAAATTATCCAAA
GAAGGATTCCAAGCTAGTGTCGATGTTCAGCAATTTAAACCAAATGAAATCTCTGTCAAA
GTTCAAGATCACACTGTCATAATTGAAGGAAAGCATGAAGAACGAGATGATGCACATGGA
ACCATTGAAAGAAGTTTTGTTCGCAAATATGTGTTGCCACAAGAATACGACATGAATACA
GTTCAATCAACTTTGTCAAGTGATGGAGTTTTGACTGTCAAAGCACCGCCACCAACGCAA
GCTATTGAAGGAACTAAGGAAAGAAATATTGAAATCACTCATACAAATGCACCAGCTCGT
GAAAGTGTTAAGGATAAATCACAGAATGATGATAAGAAATAA

>g17055.t1 Gene=g17055 Length=173
MSSIVRALLRDPYFAYELRPRFGMIPNDFFYPITYYRPWQMVCEAFSELNEDQSSIKLSK
EGFQASVDVQQFKPNEISVKVQDHTVIIEGKHEERDDAHGTIERSFVRKYVLPQEYDMNT
VQSTLSSDGVLTVKAPPPTQAIEGTKERNIEITHTNAPARESVKDKSQNDDKK

Protein features from InterProScan

Transcript Database ID Name Start End E.value
11 g17055.t1 CDD cd06526 metazoan_ACD 60 136 3.10957E-39
10 g17055.t1 Gene3D G3DSA:2.60.40.790 - 34 173 3.9E-32
13 g17055.t1 MobiDBLite mobidb-lite consensus disorder prediction 135 173 -
12 g17055.t1 MobiDBLite mobidb-lite consensus disorder prediction 147 173 -
2 g17055.t1 PANTHER PTHR45640:SF23 HEAT SHOCK PROTEIN 22-RELATED 48 166 3.5E-44
3 g17055.t1 PANTHER PTHR45640 HEAT SHOCK PROTEIN HSP-12.2-RELATED 48 166 3.5E-44
8 g17055.t1 PRINTS PR00299 Alpha crystallin signature 57 77 9.4E-19
6 g17055.t1 PRINTS PR00299 Alpha crystallin signature 79 92 9.4E-19
5 g17055.t1 PRINTS PR00299 Alpha crystallin signature 94 113 9.4E-19
4 g17055.t1 PRINTS PR00299 Alpha crystallin signature 116 137 9.4E-19
7 g17055.t1 PRINTS PR00299 Alpha crystallin signature 147 162 9.4E-19
1 g17055.t1 Pfam PF00011 Hsp20/alpha crystallin family 56 152 2.0E-26
14 g17055.t1 ProSiteProfiles PS01031 Small heat shock protein (sHSP) domain profile. 44 153 21.22
9 g17055.t1 SUPERFAMILY SSF49764 HSP20-like chaperones 56 152 2.58E-14

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values