| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g17055 | g17055.t3 | TSS | g17055.t3 | 12326778 | 12326778 |
| chr_4 | g17055 | g17055.t3 | isoform | g17055.t3 | 12326918 | 12327543 |
| chr_4 | g17055 | g17055.t3 | exon | g17055.t3.exon1 | 12326918 | 12326970 |
| chr_4 | g17055 | g17055.t3 | cds | g17055.t3.CDS1 | 12326964 | 12326970 |
| chr_4 | g17055 | g17055.t3 | exon | g17055.t3.exon2 | 12327071 | 12327543 |
| chr_4 | g17055 | g17055.t3 | cds | g17055.t3.CDS2 | 12327071 | 12327543 |
| chr_4 | g17055 | g17055.t3 | TTS | g17055.t3 | 12327624 | 12327624 |
>g17055.t3 Gene=g17055 Length=526
ATGTCAAGCATAGTTCGTGCACTTCTTAGAGATCCATATTTTGCTTATGGTAAAATTAAG
ACCAAGATTTGGAATGATTCCAAATGACTTTTTCTATCCAATAACATATTATCGTCCATG
GCAAATGGTTTGTGAAGCTTTCAGTGAATTAAATGAAGATCAAAGTTCAATTAAATTATC
CAAAGAAGGATTCCAAGCTAGTGTCGATGTTCAGCAATTTAAACCAAATGAAATCTCTGT
CAAAGTTCAAGATCACACTGTCATAATTGAAGGAAAGCATGAAGAACGAGATGATGCACA
TGGAACCATTGAAAGAAGTTTTGTTCGCAAATATGTGTTGCCACAAGAATACGACATGAA
TACAGTTCAATCAACTTTGTCAAGTGATGGAGTTTTGACTGTCAAAGCACCGCCACCAAC
GCAAGCTATTGAAGGAACTAAGGAAAGAAATATTGAAATCACTCATACAAATGCACCAGC
TCGTGAAAGTGTTAAGGATAAATCACAGAATGATGATAAGAAATAA
>g17055.t3 Gene=g17055 Length=159
MVKLRPRFGMIPNDFFYPITYYRPWQMVCEAFSELNEDQSSIKLSKEGFQASVDVQQFKP
NEISVKVQDHTVIIEGKHEERDDAHGTIERSFVRKYVLPQEYDMNTVQSTLSSDGVLTVK
APPPTQAIEGTKERNIEITHTNAPARESVKDKSQNDDKK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 12 | g17055.t3 | CDD | cd06526 | metazoan_ACD | 46 | 122 | 9.41044E-39 |
| 10 | g17055.t3 | Gene3D | G3DSA:2.60.40.790 | - | 20 | 159 | 3.0E-32 |
| 14 | g17055.t3 | MobiDBLite | mobidb-lite | consensus disorder prediction | 121 | 159 | - |
| 13 | g17055.t3 | MobiDBLite | mobidb-lite | consensus disorder prediction | 133 | 159 | - |
| 2 | g17055.t3 | PANTHER | PTHR45640:SF23 | HEAT SHOCK PROTEIN 22-RELATED | 36 | 152 | 5.0E-44 |
| 3 | g17055.t3 | PANTHER | PTHR45640 | HEAT SHOCK PROTEIN HSP-12.2-RELATED | 36 | 152 | 5.0E-44 |
| 11 | g17055.t3 | PIRSF | PIRSF036514 | Sm_HSP_B1 | 18 | 159 | 5.9E-45 |
| 8 | g17055.t3 | PRINTS | PR00299 | Alpha crystallin signature | 43 | 63 | 7.0E-19 |
| 4 | g17055.t3 | PRINTS | PR00299 | Alpha crystallin signature | 65 | 78 | 7.0E-19 |
| 5 | g17055.t3 | PRINTS | PR00299 | Alpha crystallin signature | 80 | 99 | 7.0E-19 |
| 7 | g17055.t3 | PRINTS | PR00299 | Alpha crystallin signature | 102 | 123 | 7.0E-19 |
| 6 | g17055.t3 | PRINTS | PR00299 | Alpha crystallin signature | 133 | 148 | 7.0E-19 |
| 1 | g17055.t3 | Pfam | PF00011 | Hsp20/alpha crystallin family | 42 | 138 | 1.6E-26 |
| 15 | g17055.t3 | ProSiteProfiles | PS01031 | Small heat shock protein (sHSP) domain profile. | 30 | 139 | 21.22 |
| 9 | g17055.t3 | SUPERFAMILY | SSF49764 | HSP20-like chaperones | 42 | 138 | 2.02E-14 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed