| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g17055 | g17055.t6 | TSS | g17055.t6 | 12326778 | 12326778 |
| chr_4 | g17055 | g17055.t6 | isoform | g17055.t6 | 12326918 | 12329600 |
| chr_4 | g17055 | g17055.t6 | exon | g17055.t6.exon1 | 12326918 | 12326966 |
| chr_4 | g17055 | g17055.t6 | cds | g17055.t6.CDS1 | 12326918 | 12326966 |
| chr_4 | g17055 | g17055.t6 | exon | g17055.t6.exon2 | 12327071 | 12327613 |
| chr_4 | g17055 | g17055.t6 | cds | g17055.t6.CDS2 | 12327071 | 12327543 |
| chr_4 | g17055 | g17055.t6 | TTS | g17055.t6 | 12327624 | 12327624 |
| chr_4 | g17055 | g17055.t6 | exon | g17055.t6.exon3 | 12329580 | 12329600 |
>g17055.t6 Gene=g17055 Length=613
ATGTCAAGCATAGTTCGTGCACTTCTTAGAGATCCATATTTTGCTTATGAATTAAGACCA
AGATTTGGAATGATTCCAAATGACTTTTTCTATCCAATAACATATTATCGTCCATGGCAA
ATGGTTTGTGAAGCTTTCAGTGAATTAAATGAAGATCAAAGTTCAATTAAATTATCCAAA
GAAGGATTCCAAGCTAGTGTCGATGTTCAGCAATTTAAACCAAATGAAATCTCTGTCAAA
GTTCAAGATCACACTGTCATAATTGAAGGAAAGCATGAAGAACGAGATGATGCACATGGA
ACCATTGAAAGAAGTTTTGTTCGCAAATATGTGTTGCCACAAGAATACGACATGAATACA
GTTCAATCAACTTTGTCAAGTGATGGAGTTTTGACTGTCAAAGCACCGCCACCAACGCAA
GCTATTGAAGGAACTAAGGAAAGAAATATTGAAATCACTCATACAAATGCACCAGCTCGT
GAAAGTGTTAAGGATAAATCACAGAATGATGATAAGAAATAAAATTGTTTTTCGGATTAT
TTTAAAATGTTTATGTTCTATAAGGTTTTAAATTTGTAAATACAAAAATTGCAATTATTT
ATTAAAAAAATTT
>g17055.t6 Gene=g17055 Length=173
MSSIVRALLRDPYFAYELRPRFGMIPNDFFYPITYYRPWQMVCEAFSELNEDQSSIKLSK
EGFQASVDVQQFKPNEISVKVQDHTVIIEGKHEERDDAHGTIERSFVRKYVLPQEYDMNT
VQSTLSSDGVLTVKAPPPTQAIEGTKERNIEITHTNAPARESVKDKSQNDDKK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 11 | g17055.t6 | CDD | cd06526 | metazoan_ACD | 60 | 136 | 3.10957E-39 |
| 10 | g17055.t6 | Gene3D | G3DSA:2.60.40.790 | - | 34 | 173 | 3.9E-32 |
| 13 | g17055.t6 | MobiDBLite | mobidb-lite | consensus disorder prediction | 135 | 173 | - |
| 12 | g17055.t6 | MobiDBLite | mobidb-lite | consensus disorder prediction | 147 | 173 | - |
| 2 | g17055.t6 | PANTHER | PTHR45640:SF23 | HEAT SHOCK PROTEIN 22-RELATED | 48 | 166 | 3.5E-44 |
| 3 | g17055.t6 | PANTHER | PTHR45640 | HEAT SHOCK PROTEIN HSP-12.2-RELATED | 48 | 166 | 3.5E-44 |
| 8 | g17055.t6 | PRINTS | PR00299 | Alpha crystallin signature | 57 | 77 | 9.4E-19 |
| 6 | g17055.t6 | PRINTS | PR00299 | Alpha crystallin signature | 79 | 92 | 9.4E-19 |
| 5 | g17055.t6 | PRINTS | PR00299 | Alpha crystallin signature | 94 | 113 | 9.4E-19 |
| 4 | g17055.t6 | PRINTS | PR00299 | Alpha crystallin signature | 116 | 137 | 9.4E-19 |
| 7 | g17055.t6 | PRINTS | PR00299 | Alpha crystallin signature | 147 | 162 | 9.4E-19 |
| 1 | g17055.t6 | Pfam | PF00011 | Hsp20/alpha crystallin family | 56 | 152 | 2.0E-26 |
| 14 | g17055.t6 | ProSiteProfiles | PS01031 | Small heat shock protein (sHSP) domain profile. | 44 | 153 | 21.22 |
| 9 | g17055.t6 | SUPERFAMILY | SSF49764 | HSP20-like chaperones | 56 | 152 | 2.58E-14 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed