General information for g17089.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g17089 is located on chr_4: 12436010..12436588 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g17089 | g17089.t1 | isoform | g17089.t1 | 12436010 | 12436588 |
| chr_4 | g17089 | g17089.t1 | exon | g17089.t1.exon1 | 12436010 | 12436021 |
| chr_4 | g17089 | g17089.t1 | cds | g17089.t1.CDS1 | 12436010 | 12436021 |
| chr_4 | g17089 | g17089.t1 | exon | g17089.t1.exon2 | 12436157 | 12436165 |
| chr_4 | g17089 | g17089.t1 | cds | g17089.t1.CDS2 | 12436157 | 12436165 |
| chr_4 | g17089 | g17089.t1 | exon | g17089.t1.exon3 | 12436379 | 12436588 |
| chr_4 | g17089 | g17089.t1 | cds | g17089.t1.CDS3 | 12436379 | 12436588 |
| chr_4 | g17089 | g17089.t1 | TSS | g17089.t1 | NA | NA |
| chr_4 | g17089 | g17089.t1 | TTS | g17089.t1 | NA | NA |
Sequences
>g17089.t1 Gene=g17089 Length=231
ATGCACCATCAGGGAGTTCAGATTCAACCATTCTTGCATTCAAATGATTTAATTTTTGGA
ACTGCTCATGATTGCATTGGCTTTACATCACCTGGAATTCTTGCTGGACTTTTTGTTACT
GGAATTCTTCTATCAATTTTGGCTATTGGTATTACGGCCATTATGAATATTCATGTACCA
GATCGCTTTGACAATCGAAAATCAAAACAATTTTATCAAAATGTCCAATGA
>g17089.t1 Gene=g17089 Length=76
MHHQGVQIQPFLHSNDLIFGTAHDCIGFTSPGILAGLFVTGILLSILAIGITAIMNIHVP
DRFDNRKSKQFYQNVQ
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g17089.t1 | PANTHER | PTHR12471 | VACUOLAR ATP SYNTHASE SUBUNIT S1 | 4 | 72 | 2.0E-21 |
| 1 | g17089.t1 | Pfam | PF05827 | Vacuolar ATP synthase subunit S1 (ATP6S1) | 4 | 71 | 3.7E-23 |
| 5 | g17089.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 32 | - |
| 6 | g17089.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 33 | 59 | - |
| 4 | g17089.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 60 | 76 | - |
| 3 | g17089.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 37 | 59 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:1902600 | proton transmembrane transport | BP |
| GO:0033180 | proton-transporting V-type ATPase, V1 domain | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed