| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g17107 | g17107.t1 | isoform | g17107.t1 | 12490031 | 12490455 |
| chr_4 | g17107 | g17107.t1 | exon | g17107.t1.exon1 | 12490031 | 12490227 |
| chr_4 | g17107 | g17107.t1 | cds | g17107.t1.CDS1 | 12490031 | 12490227 |
| chr_4 | g17107 | g17107.t1 | exon | g17107.t1.exon2 | 12490290 | 12490455 |
| chr_4 | g17107 | g17107.t1 | cds | g17107.t1.CDS2 | 12490290 | 12490455 |
| chr_4 | g17107 | g17107.t1 | TSS | g17107.t1 | NA | NA |
| chr_4 | g17107 | g17107.t1 | TTS | g17107.t1 | NA | NA |
>g17107.t1 Gene=g17107 Length=363
ATGTATAAACCAATTTTGATAAAAAAACAAAAGTTGGAGTGGTCCAAAAGTTCCACCAAT
TTCAATCCTGATCAAAATCTTGGCCAGCTTATTTTGAGAATTCTTAAAATTTCACCAGAA
TCTGTGACACAAATTTCAGCTGATACAAAAGTTTCAGTCACTTGCGGTGATGTTGTTGGA
ATTGTTGCTGCAAATACTGAAAATCTTGCTCCAGCTGTTTTTGCTTGCTTTTTACTTGGA
CTTCCTGTCAATCCTTTGGCACCAATTATGATTGAAAGTGACATCGTGCATATGTTTAGC
AAAACTAAACCAAAATTGATTCTTTGTGATGAAAATTGTTTAAAAATTGTTCAAATGCTG
TGA
>g17107.t1 Gene=g17107 Length=120
MYKPILIKKQKLEWSKSSTNFNPDQNLGQLILRILKISPESVTQISADTKVSVTCGDVVG
IVAANTENLAPAVFACFLLGLPVNPLAPIMIESDIVHMFSKTKPKLILCDENCLKIVQML
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g17107.t1 | Gene3D | G3DSA:3.40.50.980 | - | 41 | 120 | 1.3E-12 |
| 1 | g17107.t1 | PANTHER | PTHR24096:SF353 | GH16244P-RELATED | 53 | 118 | 2.3E-13 |
| 2 | g17107.t1 | PANTHER | PTHR24096 | LONG-CHAIN-FATTY-ACID–COA LIGASE | 53 | 118 | 2.3E-13 |
| 4 | g17107.t1 | SUPERFAMILY | SSF56801 | Acetyl-CoA synthetase-like | 11 | 120 | 1.7E-12 |
| 3 | g17107.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 69 | 91 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed