| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| HiC_scaffold_21 | g17630 | g17630.t1 | isoform | g17630.t1 | 1 | 219 |
| HiC_scaffold_21 | g17630 | g17630.t1 | exon | g17630.t1.exon1 | 1 | 219 |
| HiC_scaffold_21 | g17630 | g17630.t1 | cds | g17630.t1.CDS1 | 1 | 219 |
| HiC_scaffold_21 | g17630 | g17630.t1 | TSS | g17630.t1 | NA | NA |
| HiC_scaffold_21 | g17630 | g17630.t1 | TTS | g17630.t1 | NA | NA |
>g17630.t1 Gene=g17630 Length=219
ATGTCAAGTGTTGATATTCGTGAAATAGAAAAATATACGAAACGAGCAAAAGTTTGGTGG
GACTTGAATGGTCCTCAAATGCTTTTGCACAAACATACTCCTGCTATAAGAATTCCTTTC
ATCATTCATGGACTTTCATCAACAGGAAAAATTAAAAACAACAACAAAAACCTTCTGCAA
GGCTTAAAAATTCTCGATGTTGGTTGCGGTGGTGGAATA
>g17630.t1 Gene=g17630 Length=73
MSSVDIREIEKYTKRAKVWWDLNGPQMLLHKHTPAIRIPFIIHGLSSTGKIKNNNKNLLQ
GLKILDVGCGGGI
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g17630.t1 | Gene3D | G3DSA:3.40.50.150 | Vaccinia Virus protein VP39 | 1 | 73 | 0e+00 |
| 1 | g17630.t1 | SUPERFAMILY | SSF53335 | S-adenosyl-L-methionine-dependent methyltransferases | 10 | 73 | 3e-06 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed