| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1791 | g1791.t2 | isoform | g1791.t2 | 13033606 | 13034301 |
| chr_3 | g1791 | g1791.t2 | exon | g1791.t2.exon1 | 13033606 | 13033830 |
| chr_3 | g1791 | g1791.t2 | cds | g1791.t2.CDS1 | 13033606 | 13033830 |
| chr_3 | g1791 | g1791.t2 | exon | g1791.t2.exon2 | 13033896 | 13034010 |
| chr_3 | g1791 | g1791.t2 | cds | g1791.t2.CDS2 | 13033896 | 13034010 |
| chr_3 | g1791 | g1791.t2 | exon | g1791.t2.exon3 | 13034072 | 13034301 |
| chr_3 | g1791 | g1791.t2 | cds | g1791.t2.CDS3 | 13034072 | 13034295 |
| chr_3 | g1791 | g1791.t2 | TSS | g1791.t2 | NA | NA |
| chr_3 | g1791 | g1791.t2 | TTS | g1791.t2 | NA | NA |
>g1791.t2 Gene=g1791 Length=570
CTACTTATGGTCGTTCATTTCAAGCATCATTGTAATACATATGGCAGCTTGTCAGCATAT
ATTGTGGCTTTCTTCGTTCGTCTATCAGGAGGCGAACCGATTCTTGGTTTACCAGCAGCA
ATTCATTTTCCTGGTTATGATGAGGAAACACAAGAGCAACTTTTTCCATTCCGCACAATG
GCTATGTTGCTTAGTCTAATAACATTGGCTGGAGTTTCTTGGTTAACAAAATTCCTTTTC
TTAACTGGAAGACTTGCGCCACAATATGATTACTTTAGATGTGTTGTGAATATACCAGAA
GATGCTGTGCGTGTCGGAGATCCATCAGAAGTTGACGGCGAACAGATGAGTGTGATGGCT
GGCGCTATGAACAAAATGTATGGCGCAGCAACAATGGTGGGCAAGGATGAAAGAAATGGA
AGAATAAATCCAGCACTTGAGCCAGATGATGATCTACCAGCTGTTGAAGCACAAAGGCAA
ATGCAACAAATGGCACTTAGCAATGCTGCTGCTGCCATAAGTAATGTAGCCCAAACCGTC
CCTGGTGGACAAGGCACTACGGCATTTTAA
>g1791.t2 Gene=g1791 Length=187
MVVHFKHHCNTYGSLSAYIVAFFVRLSGGEPILGLPAAIHFPGYDEETQEQLFPFRTMAM
LLSLITLAGVSWLTKFLFLTGRLAPQYDYFRCVVNIPEDAVRVGDPSEVDGEQMSVMAGA
MNKMYGAATMVGKDERNGRINPALEPDDDLPAVEAQRQMQQMALSNAAAAISNVAQTVPG
GQGTTAF
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g1791.t2 | PANTHER | PTHR45897 | HIGH-AFFINITY CHOLINE TRANSPORTER 1 | 1 | 112 | 3.8E-30 |
| 2 | g1791.t2 | PANTHER | PTHR45897:SF4 | HIGH-AFFINITY CHOLINE TRANSPORTER 1 | 1 | 112 | 3.8E-30 |
| 5 | g1791.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 11 | - |
| 8 | g1791.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 33 | - |
| 7 | g1791.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 34 | 52 | - |
| 9 | g1791.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 53 | 73 | - |
| 6 | g1791.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 74 | 187 | - |
| 3 | g1791.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 34 | - |
| 4 | g1791.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 57 | 79 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed