| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g183 | g183.t1 | TSS | g183.t1 | 1570119 | 1570119 |
| chr_3 | g183 | g183.t1 | isoform | g183.t1 | 1570184 | 1570635 |
| chr_3 | g183 | g183.t1 | exon | g183.t1.exon1 | 1570184 | 1570363 |
| chr_3 | g183 | g183.t1 | cds | g183.t1.CDS1 | 1570184 | 1570363 |
| chr_3 | g183 | g183.t1 | exon | g183.t1.exon2 | 1570471 | 1570635 |
| chr_3 | g183 | g183.t1 | cds | g183.t1.CDS2 | 1570471 | 1570635 |
| chr_3 | g183 | g183.t1 | TTS | g183.t1 | 1571496 | 1571496 |
>g183.t1 Gene=g183 Length=345
ATGAAGCCAATTGGATATTTTGACATTCAAAATGAAGACGATTTTAATGAAAAAGTACTC
AATTGTAACAATCCAGTGCTTGTCGGTTTCTATGCTCCATGGTGTGAATCGTGCAGGGTT
ACTATGCCAAAATTAGAGAAAGTTGTTGAAGAAAATGATGGAAAAATTCGTTTGGCAAAA
GTCAACATTGATGATAAGGCATTACAAGACTTGGCGATTAAATACAATTTTAAATCAGTT
CCAGTAACTGCTGTGATTAAAGATGGAAAACTTCGATCACAATTAGTTGGAAAGCAAGAA
TTGGAAAATGTTAGACAATTTGTGCAGTCAACTCTTAATGAATAA
>g183.t1 Gene=g183 Length=114
MKPIGYFDIQNEDDFNEKVLNCNNPVLVGFYAPWCESCRVTMPKLEKVVEENDGKIRLAK
VNIDDKALQDLAIKYNFKSVPVTAVIKDGKLRSQLVGKQELENVRQFVQSTLNE
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g183.t1 | CDD | cd02947 | TRX_family | 13 | 109 | 8.74101E-23 |
| 5 | g183.t1 | Gene3D | G3DSA:3.40.30.10 | Glutaredoxin | 4 | 112 | 1.6E-27 |
| 2 | g183.t1 | PANTHER | PTHR43601:SF3 | THIOREDOXIN, MITOCHONDRIAL | 6 | 108 | 6.3E-23 |
| 3 | g183.t1 | PANTHER | PTHR43601 | THIOREDOXIN, MITOCHONDRIAL | 6 | 108 | 6.3E-23 |
| 6 | g183.t1 | PIRSF | PIRSF000077 | Thioredoxin | 6 | 112 | 5.2E-25 |
| 1 | g183.t1 | Pfam | PF00085 | Thioredoxin | 10 | 109 | 5.8E-21 |
| 8 | g183.t1 | ProSitePatterns | PS00194 | Thioredoxin family active site. | 27 | 45 | - |
| 9 | g183.t1 | ProSiteProfiles | PS51352 | Thioredoxin domain profile. | 1 | 113 | 12.151 |
| 4 | g183.t1 | SUPERFAMILY | SSF52833 | Thioredoxin-like | 7 | 113 | 5.36E-27 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0015035 | protein-disulfide reductase activity | MF |
| GO:0006662 | glycerol ether metabolic process | BP |
| GO:0045454 | cell redox homeostasis | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed