General information for g1928.t8
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Phosphatidate phosphatase LPIN3.
Parent gene
- The parent gene g1928 is located on chr_3: 13948055..13950577 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1928 | g1928.t8 | TTS | g1928.t8 | 13947738 | 13947738 |
| chr_3 | g1928 | g1928.t8 | isoform | g1928.t8 | 13947964 | 13948466 |
| chr_3 | g1928 | g1928.t8 | exon | g1928.t8.exon1 | 13947964 | 13947976 |
| chr_3 | g1928 | g1928.t8 | cds | g1928.t8.CDS1 | 13947964 | 13947976 |
| chr_3 | g1928 | g1928.t8 | exon | g1928.t8.exon2 | 13948040 | 13948209 |
| chr_3 | g1928 | g1928.t8 | cds | g1928.t8.CDS2 | 13948040 | 13948209 |
| chr_3 | g1928 | g1928.t8 | exon | g1928.t8.exon3 | 13948284 | 13948466 |
| chr_3 | g1928 | g1928.t8 | cds | g1928.t8.CDS3 | 13948284 | 13948466 |
| chr_3 | g1928 | g1928.t8 | TSS | g1928.t8 | NA | NA |
Sequences
>g1928.t8 Gene=g1928 Length=366
ATGTTAAGCATCGCAAATAAAGTATTTCGTGATTTTAAAGAGTTCTATAGCGAAATTAAT
GCAGCAACATTAACAGGAGCTATAGATGTAATTGTTGTTGAACAACCAAATGGAACATAT
TTATGCTCACCATTTCATGTTCGCTTTGGAAAGCTTGGTGTACTACGGAGTCGTGAAAAA
ATCGTCGATATTGAAATAAATGGAGAGCCAGTTGACATTCACATGAAATTGGGTGAATCT
GGAGAAGCATTTTTTGTAGAGGAATGCTCAGAAGGTGATTTAGATGAGCTTCCAAATTTA
GCGACATCACCAATTCCTACAAGTGAAATGACAAATTATGAAAGCTCGATTAATACATCA
AATACC
>g1928.t8 Gene=g1928 Length=122
MLSIANKVFRDFKEFYSEINAATLTGAIDVIVVEQPNGTYLCSPFHVRFGKLGVLRSREK
IVDIEINGEPVDIHMKLGESGEAFFVEECSEGDLDELPNLATSPIPTSEMTNYESSINTS
NT
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g1928.t8 | MobiDBLite | mobidb-lite | consensus disorder prediction | 102 | 122 | - |
| 2 | g1928.t8 | PANTHER | PTHR12181 | LIPIN | 4 | 110 | 1.3E-49 |
| 3 | g1928.t8 | PANTHER | PTHR12181:SF11 | PHOSPHATIDATE PHOSPHATASE LPIN2 | 4 | 110 | 1.3E-49 |
| 1 | g1928.t8 | Pfam | PF04571 | lipin, N-terminal conserved region | 4 | 104 | 1.6E-43 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed