| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2010 | g2010.t5 | TTS | g2010.t5 | 14385612 | 14385612 |
| chr_3 | g2010 | g2010.t5 | isoform | g2010.t5 | 14385683 | 14386233 |
| chr_3 | g2010 | g2010.t5 | exon | g2010.t5.exon1 | 14385683 | 14385805 |
| chr_3 | g2010 | g2010.t5 | cds | g2010.t5.CDS1 | 14385683 | 14385805 |
| chr_3 | g2010 | g2010.t5 | exon | g2010.t5.exon2 | 14385890 | 14386063 |
| chr_3 | g2010 | g2010.t5 | cds | g2010.t5.CDS2 | 14385890 | 14386063 |
| chr_3 | g2010 | g2010.t5 | exon | g2010.t5.exon3 | 14386231 | 14386233 |
| chr_3 | g2010 | g2010.t5 | cds | g2010.t5.CDS3 | 14386231 | 14386233 |
| chr_3 | g2010 | g2010.t5 | TSS | g2010.t5 | 14386293 | 14386293 |
>g2010.t5 Gene=g2010 Length=300
ATGGTGAACGTTCCAAAACAACGCAGAACTTATTGCCGTAAATGTAACGCACATCGCGTT
CATAAGGTATCGCAATACAAAAAATCAAAGGAAAGAAAGGCTTCACAAGGTCGTCGTCGT
TACGACAGAAAACAACAAGGTTTTGGTGGTCAAACCAAACCAATTTTCAGAAAGAAGAAA
ATTGTTCTTCGTATGGAATGTACTGAATGCAAATTCCGCAAACAAACACCAATTCGTCGT
TGTAAACATTTTGAATTGGGAGGAGACAAGAAACGCAAGGGACAAATGATTCAGTTCTAA
>g2010.t5 Gene=g2010 Length=99
MVNVPKQRRTYCRKCNAHRVHKVSQYKKSKERKASQGRRRYDRKQQGFGGQTKPIFRKKK
IVLRMECTECKFRKQTPIRRCKHFELGGDKKRKGQMIQF
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g2010.t5 | Gene3D | G3DSA:3.10.450.80 | - | 1 | 99 | 2.1E-44 |
| 6 | g2010.t5 | MobiDBLite | mobidb-lite | consensus disorder prediction | 22 | 55 | - |
| 5 | g2010.t5 | MobiDBLite | mobidb-lite | consensus disorder prediction | 29 | 46 | - |
| 2 | g2010.t5 | PANTHER | PTHR10369:SF3 | RIBOSOMAL PROTEIN L36A LIKE | 1 | 99 | 2.1E-40 |
| 3 | g2010.t5 | PANTHER | PTHR10369 | 60S RIBOSOMAL PROTEIN L36A/L44 | 1 | 99 | 2.1E-40 |
| 1 | g2010.t5 | Pfam | PF00935 | Ribosomal protein L44 | 18 | 86 | 8.3E-26 |
| 4 | g2010.t5 | SUPERFAMILY | SSF57829 | Zn-binding ribosomal proteins | 2 | 87 | 5.68E-31 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed