| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2010 | g2010.t9 | TTS | g2010.t9 | 14385612 | 14385612 |
| chr_3 | g2010 | g2010.t9 | isoform | g2010.t9 | 14385683 | 14388607 |
| chr_3 | g2010 | g2010.t9 | exon | g2010.t9.exon1 | 14385683 | 14385820 |
| chr_3 | g2010 | g2010.t9 | cds | g2010.t9.CDS1 | 14385683 | 14385790 |
| chr_3 | g2010 | g2010.t9 | exon | g2010.t9.exon2 | 14385890 | 14386063 |
| chr_3 | g2010 | g2010.t9 | exon | g2010.t9.exon3 | 14388563 | 14388607 |
| chr_3 | g2010 | g2010.t9 | TSS | g2010.t9 | NA | NA |
>g2010.t9 Gene=g2010 Length=357
TTGTTCTTCGTTCAGTGTACATTTTCACTCGACTATCGAAGAAAAGTGAACGTTCCAAAA
CAACGCAGAACTTATTGCCGTAAATGTAACGCACATCGCGTTCATAAGGTATCGCAATAC
AAAAAATCAAAGGAAAGAAAGGCTTCACAAGGTCGTCGTCGTTACGACAGAAAACAACAA
GGTTTTGGTGGTCAAACCAAACCAATTTTCAGAAAGAAGGCCAAAACTACCAAGAAAATT
GTTCTTCGTATGGAATGTACTGAATGCAAATTCCGCAAACAAACACCAATTCGTCGTTGT
AAACATTTTGAATTGGGAGGAGACAAGAAACGCAAGGGACAAATGATTCAGTTCTAA
>g2010.t9 Gene=g2010 Length=35
MECTECKFRKQTPIRRCKHFELGGDKKRKGQMIQF
| Transcript | Database | ID | Name | Start | End | E.value |
|---|---|---|---|---|---|---|
| g2010.t9 | Gene3D | G3DSA:3.10.450.80 | - | 1 | 35 | 0 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed