| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2021 | g2021.t1 | isoform | g2021.t1 | 14557189 | 14558001 |
| chr_3 | g2021 | g2021.t1 | exon | g2021.t1.exon1 | 14557189 | 14557440 |
| chr_3 | g2021 | g2021.t1 | cds | g2021.t1.CDS1 | 14557189 | 14557440 |
| chr_3 | g2021 | g2021.t1 | exon | g2021.t1.exon2 | 14557788 | 14557870 |
| chr_3 | g2021 | g2021.t1 | cds | g2021.t1.CDS2 | 14557788 | 14557870 |
| chr_3 | g2021 | g2021.t1 | exon | g2021.t1.exon3 | 14557929 | 14558001 |
| chr_3 | g2021 | g2021.t1 | cds | g2021.t1.CDS3 | 14557929 | 14558001 |
| chr_3 | g2021 | g2021.t1 | TSS | g2021.t1 | 14558096 | 14558096 |
| chr_3 | g2021 | g2021.t1 | TTS | g2021.t1 | NA | NA |
>g2021.t1 Gene=g2021 Length=408
ATGTCAAATAAGAGTTCTATGCTCTCAAAATTGGCAGATACTATTTCAGAATATAGTTGG
AGCGATGCATCAGATGGTGCATCAACAACGACGGCAACAGCTTCGAATGCTGTAAAAAAT
AATGAACTTCAACCGAATAATGGTGAATTAAAGACCAACCAGCCATTGAAACCAGCTGAA
GAAACTGGACAAGATGTTATCGGTGATTACGAAGAAGGACTCGATGGTTTTAAACGTGAT
TTCATTACAAGAATATGGATGACTTATAGGAAAGACTTTGCAATGATGCCAGCAGAAGTG
AAAAGTAACTCACCTAATTCTCCAAGTAGTAGTAATGGAGGATACACTTCTGATTGCGGT
TGGGGTTGCATGATTAGATCAGGACAAATGTTGCTTGCACAGCACTAG
>g2021.t1 Gene=g2021 Length=135
MSNKSSMLSKLADTISEYSWSDASDGASTTTATASNAVKNNELQPNNGELKTNQPLKPAE
ETGQDVIGDYEEGLDGFKRDFITRIWMTYRKDFAMMPAEVKSNSPNSPSSSNGGYTSDCG
WGCMIRSGQMLLAQH
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g2021.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 19 | 59 | - |
| 6 | g2021.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 19 | 62 | - |
| 2 | g2021.t1 | PANTHER | PTHR22624:SF52 | CYSTEINE PROTEASE | 53 | 134 | 1.1E-19 |
| 3 | g2021.t1 | PANTHER | PTHR22624 | CYSTEINE PROTEASE ATG4 | 53 | 134 | 1.1E-19 |
| 1 | g2021.t1 | Pfam | PF03416 | Peptidase family C54 | 76 | 134 | 2.4E-18 |
| 4 | g2021.t1 | SUPERFAMILY | SSF54001 | Cysteine proteinases | 70 | 134 | 8.83E-20 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed