General information for g2090.t1
Yuki Yoshida
6/2/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g2090 is located on chr_3: 15101274..15103053 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2090 | g2090.t1 | isoform | g2090.t1 | 15101274 | 15103053 |
| chr_3 | g2090 | g2090.t1 | exon | g2090.t1.exon1 | 15101274 | 15101607 |
| chr_3 | g2090 | g2090.t1 | cds | g2090.t1.CDS1 | 15101274 | 15101607 |
| chr_3 | g2090 | g2090.t1 | exon | g2090.t1.exon2 | 15103037 | 15103053 |
| chr_3 | g2090 | g2090.t1 | cds | g2090.t1.CDS2 | 15103037 | 15103053 |
| chr_3 | g2090 | g2090.t1 | TSS | g2090.t1 | NA | NA |
| chr_3 | g2090 | g2090.t1 | TTS | g2090.t1 | NA | NA |
Sequences
>g2090.t1 Gene=g2090 Length=351
ATGACTTTATTCAATGGCAAATATTTGATAAAAACAATCGATTTGAACTTTAAAAATTAC
AAATTTTGCAACGAAATTAGTCTTCAACTAAGATTCAAACAATGGATAGGAAAAACTGCG
ATTGTAACTCGAGCTTCTGCCGGCATTGGGGTAGCAATTGTAAGAGATTTTGCAAATGCT
GGTACTAATGTTATTGCTATAGCTCGTCGACTTGAAAAATGCAAAAGGCAAAGATACACC
AATGAATGCGATGTTTTTGACAAAGTTTCAATCTATACTGCTTTTGATGAAATTGAAGAA
AAGTTTGATAGTGCTCAAATTTTAGTAAATAATGATGGTATTGCAATCTAA
>g2090.t1 Gene=g2090 Length=116
MTLFNGKYLIKTIDLNFKNYKFCNEISLQLRFKQWIGKTAIVTRASAGIGVAIVRDFANA
GTNVIAIARRLEKCKRQRYTNECDVFDKVSIYTAFDEIEEKFDSAQILVNNDGIAI
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g2090.t1 | Gene3D | G3DSA:3.40.50.720 | - | 31 | 116 | 0.0e+00 |
| 2 | g2090.t1 | PANTHER | PTHR24322 | PKSB | 35 | 115 | 0.0e+00 |
| 3 | g2090.t1 | PANTHER | PTHR24322:SF736 | PKSB | 35 | 115 | 0.0e+00 |
| 4 | g2090.t1 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature | 39 | 56 | 6.6e-05 |
| 5 | g2090.t1 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature | 103 | 114 | 6.6e-05 |
| 1 | g2090.t1 | Pfam | PF00106 | short chain dehydrogenase | 38 | 114 | 0.0e+00 |
| 6 | g2090.t1 | SUPERFAMILY | SSF51735 | NAD(P)-binding Rossmann-fold domains | 34 | 115 | 0.0e+00 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
## [1] "No matching GO terms"KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed