General information for g2099.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Protein O-mannosyl-transferase 2.
Parent gene
- The parent gene g2099 is located on chr_3: 15201607..15203401 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2099 | g2099.t1 | isoform | g2099.t1 | 15201607 | 15203401 |
| chr_3 | g2099 | g2099.t1 | exon | g2099.t1.exon1 | 15201607 | 15201811 |
| chr_3 | g2099 | g2099.t1 | cds | g2099.t1.CDS1 | 15201607 | 15201811 |
| chr_3 | g2099 | g2099.t1 | exon | g2099.t1.exon2 | 15202230 | 15202370 |
| chr_3 | g2099 | g2099.t1 | cds | g2099.t1.CDS2 | 15202230 | 15202370 |
| chr_3 | g2099 | g2099.t1 | exon | g2099.t1.exon3 | 15203211 | 15203401 |
| chr_3 | g2099 | g2099.t1 | cds | g2099.t1.CDS3 | 15203211 | 15203401 |
| chr_3 | g2099 | g2099.t1 | TSS | g2099.t1 | NA | NA |
| chr_3 | g2099 | g2099.t1 | TTS | g2099.t1 | NA | NA |
Sequences
>g2099.t1 Gene=g2099 Length=537
ATGTTGATAATCTATTTTTTTCATTCTCATCTTTTTTTGCAGGGTCAATATTTTAGTGGT
GGCAACTATCGAATTTATTTACTTGGAAATCCAATTATATGGTGGAGCAATTTGGTTTTT
CTTGCATTGTTTCTGCTCACATATTTCATCGCAGCTGTAAAACAACAACGTGGCTTTGAT
GATAATGAAAATTCTGATAACAAAGAAAATAAATGGCGTTCATTAGGAGCTGGTTCATGG
CTATTCATCGGATGGATTTTGCACTATTTACCATTCTGGGCTATGGGACGTGTGTTGTAT
TTTCATCACTACTTTCCTGCCGTCATTTTCAATTCAATGCTAACAGGCGTAATGTTCAAC
TATCTTATTCAGCGGATGCCAAATTGGATAAAACAAATAGCACTTGGCACCATTCTCGGC
ATTATTCTATACAGTTTCAAATTGTTTTATCCGCTTGCGTATGGATTTGCTGATGCATCG
ACTGAAAAAAATTCTACAATGCATGGATTACGTTGGATGGATTCGTGGGAGTTTTGA
>g2099.t1 Gene=g2099 Length=178
MLIIYFFHSHLFLQGQYFSGGNYRIYLLGNPIIWWSNLVFLALFLLTYFIAAVKQQRGFD
DNENSDNKENKWRSLGAGSWLFIGWILHYLPFWAMGRVLYFHHYFPAVIFNSMLTGVMFN
YLIQRMPNWIKQIALGTILGIILYSFKLFYPLAYGFADASTEKNSTMHGLRWMDSWEF
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g2099.t1 | PANTHER | PTHR10050 | DOLICHYL-PHOSPHATE-MANNOSE–PROTEIN MANNOSYLTRANSFERASE | 11 | 178 | 1.6E-52 |
| 3 | g2099.t1 | PANTHER | PTHR10050:SF46 | PROTEIN O-MANNOSYL-TRANSFERASE 2 | 11 | 178 | 1.6E-52 |
| 1 | g2099.t1 | Pfam | PF16192 | C-terminal four TMM region of protein-O-mannosyltransferase | 18 | 176 | 1.6E-42 |
| 11 | g2099.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 31 | - |
| 14 | g2099.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 32 | 53 | - |
| 9 | g2099.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 54 | 73 | - |
| 13 | g2099.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 74 | 92 | - |
| 12 | g2099.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 93 | 103 | - |
| 16 | g2099.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 104 | 123 | - |
| 8 | g2099.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 124 | 134 | - |
| 15 | g2099.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 135 | 157 | - |
| 10 | g2099.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 158 | 178 | - |
| 4 | g2099.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 31 | 53 | - |
| 5 | g2099.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 74 | 96 | - |
| 6 | g2099.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 101 | 123 | - |
| 7 | g2099.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 135 | 157 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed