General information for g222.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Mitochondrial pyruvate carrier-like protein.
Parent gene
- The parent gene g222 is located on chr_3: 1862144..1862848 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g222 | g222.t1 | TTS | g222.t1 | 1861965 | 1861965 |
| chr_3 | g222 | g222.t1 | isoform | g222.t1 | 1862144 | 1862749 |
| chr_3 | g222 | g222.t1 | exon | g222.t1.exon1 | 1862144 | 1862358 |
| chr_3 | g222 | g222.t1 | cds | g222.t1.CDS1 | 1862144 | 1862358 |
| chr_3 | g222 | g222.t1 | exon | g222.t1.exon2 | 1862424 | 1862524 |
| chr_3 | g222 | g222.t1 | cds | g222.t1.CDS2 | 1862424 | 1862524 |
| chr_3 | g222 | g222.t1 | exon | g222.t1.exon3 | 1862682 | 1862749 |
| chr_3 | g222 | g222.t1 | cds | g222.t1.CDS3 | 1862682 | 1862749 |
| chr_3 | g222 | g222.t1 | TSS | g222.t1 | 1862991 | 1862991 |
Sequences
>g222.t1 Gene=g222 Length=384
ATGTCAAAAATCGGGAAGAAATTAGCTGAGAGTCTCAAATCCAAAGAATTTCGTGATTAT
CTCATGAGTACACATTTTTGGGGTCCCGTTGCCAACTGGGGCATTCCGATTGCTTGTTTA
ATGGATATTAGGAAAGATCCAAAAATTATATCCGGCACTATGACCACTGCTCTAGTGCTG
TATTCTTGCGTATTCATGAGATTTGCTTGGCGAGTGAAACCTCAAAATATGCTGCTATTT
GCATGCCATTTTACAAATGCAACAGCTCAATCAATTCAAGGTGGAAGATTTATAGCATAT
CATTATTTAGGAGGCAAAGAACGACTCGAGAGAGAAGAAGCAGCTAGAGAAAAAGTTGAG
GAAATTATTAAAGCACACAATTAA
>g222.t1 Gene=g222 Length=127
MSKIGKKLAESLKSKEFRDYLMSTHFWGPVANWGIPIACLMDIRKDPKIISGTMTTALVL
YSCVFMRFAWRVKPQNMLLFACHFTNATAQSIQGGRFIAYHYLGGKERLEREEAAREKVE
EIIKAHN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g222.t1 | PANTHER | PTHR14154:SF9 | MITOCHONDRIAL PYRUVATE CARRIER 1-LIKE PROTEIN | 6 | 112 | 2.7E-45 |
| 3 | g222.t1 | PANTHER | PTHR14154 | UPF0041 BRAIN PROTEIN 44-RELATED | 6 | 112 | 2.7E-45 |
| 1 | g222.t1 | Pfam | PF03650 | Mitochondrial pyruvate carriers | 15 | 117 | 3.3E-35 |
| 6 | g222.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 19 | - |
| 8 | g222.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 43 | - |
| 7 | g222.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 44 | 48 | - |
| 9 | g222.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 49 | 70 | - |
| 5 | g222.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 71 | 127 | - |
| 4 | g222.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 49 | 71 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006850 | mitochondrial pyruvate transmembrane transport | BP |
| GO:0005743 | mitochondrial inner membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K22138 (mitochondrial pyruvate carrier 1)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
