General information for g224.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Dynamin-1-like protein.
Parent gene
- The parent gene g224 is located on chr_3: 1870383..1871129 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g224 | g224.t1 | isoform | g224.t1 | 1870383 | 1871129 |
| chr_3 | g224 | g224.t1 | exon | g224.t1.exon1 | 1870383 | 1870608 |
| chr_3 | g224 | g224.t1 | cds | g224.t1.CDS1 | 1870383 | 1870608 |
| chr_3 | g224 | g224.t1 | exon | g224.t1.exon2 | 1870891 | 1871053 |
| chr_3 | g224 | g224.t1 | cds | g224.t1.CDS2 | 1870891 | 1871053 |
| chr_3 | g224 | g224.t1 | exon | g224.t1.exon3 | 1871108 | 1871129 |
| chr_3 | g224 | g224.t1 | cds | g224.t1.CDS3 | 1871108 | 1871129 |
| chr_3 | g224 | g224.t1 | TSS | g224.t1 | 1871283 | 1871283 |
| chr_3 | g224 | g224.t1 | TTS | g224.t1 | NA | NA |
Sequences
>g224.t1 Gene=g224 Length=411
ATGCTAGGATCGCAATCAACAGGCAAAAGTTCTGTGCTTGAATCGATTGTTCGAAGACCA
TTTTTGCCTCGTGGATCTGGAATTGTGACTCGTTGTCCATTAGTATTGCAATTGATTGAA
TGTCCACTTGATGATCGCAAATATCGACGTGAAAATAATGGAACAATTGATGTCAAAGAA
TGGGGTGCAGCAAATGTTGATTTGGCAACAAGTGAAAGCTTGAAATATGCAAAAGAAGTC
GATCCTGATGGCAAACGAACATTAGCTGTTTTGACAAAAATTGATTTGATGGATGCAGGT
ACTGATGCGAATGAAATGCTTACTGGTGCAGTTTATTCCTGTAAAACTTGGTATTGTTGG
GTGTCATCAAATCGCTCACAACTTGATATCAATAATAAAAACTATCGCTGA
>g224.t1 Gene=g224 Length=136
MLGSQSTGKSSVLESIVRRPFLPRGSGIVTRCPLVLQLIECPLDDRKYRRENNGTIDVKE
WGAANVDLATSESLKYAKEVDPDGKRTLAVLTKIDLMDAGTDANEMLTGAVYSCKTWYCW
VSSNRSQLDINNKNYR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g224.t1 | Gene3D | G3DSA:3.40.50.300 | - | 2 | 44 | 8.8E-19 |
| 9 | g224.t1 | Gene3D | G3DSA:3.40.50.300 | - | 63 | 133 | 1.4E-24 |
| 2 | g224.t1 | PANTHER | PTHR11566:SF39 | DYNAMIN-1-LIKE PROTEIN | 2 | 52 | 2.4E-37 |
| 4 | g224.t1 | PANTHER | PTHR11566 | DYNAMIN | 2 | 52 | 2.4E-37 |
| 3 | g224.t1 | PANTHER | PTHR11566:SF39 | DYNAMIN-1-LIKE PROTEIN | 62 | 134 | 2.4E-37 |
| 5 | g224.t1 | PANTHER | PTHR11566 | DYNAMIN | 62 | 134 | 2.4E-37 |
| 1 | g224.t1 | Pfam | PF00350 | Dynamin family | 2 | 43 | 1.0E-13 |
| 8 | g224.t1 | ProSitePatterns | PS00410 | Dynamin-type guanine nucleotide-binding (G) domain signature. | 22 | 31 | - |
| 7 | g224.t1 | SMART | SM00053 | dynamin_3 | 1 | 133 | 2.0E-8 |
| 6 | g224.t1 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases | 2 | 122 | 2.1E-20 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005525 | GTP binding | MF |
| GO:0016559 | peroxisome fission | BP |
| GO:0003924 | GTPase activity | MF |
| GO:0000266 | mitochondrial fission | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
