General information for g2422.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Angiotensin-converting enzyme.
Parent gene
- The parent gene g2422 is located on chr_3: 17886299..17887561 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2422 | g2422.t1 | isoform | g2422.t1 | 17886299 | 17887561 |
| chr_3 | g2422 | g2422.t1 | exon | g2422.t1.exon1 | 17886299 | 17886407 |
| chr_3 | g2422 | g2422.t1 | cds | g2422.t1.CDS1 | 17886299 | 17886407 |
| chr_3 | g2422 | g2422.t1 | exon | g2422.t1.exon2 | 17886469 | 17886657 |
| chr_3 | g2422 | g2422.t1 | cds | g2422.t1.CDS2 | 17886469 | 17886657 |
| chr_3 | g2422 | g2422.t1 | exon | g2422.t1.exon3 | 17886712 | 17886852 |
| chr_3 | g2422 | g2422.t1 | cds | g2422.t1.CDS3 | 17886712 | 17886852 |
| chr_3 | g2422 | g2422.t1 | exon | g2422.t1.exon4 | 17887554 | 17887561 |
| chr_3 | g2422 | g2422.t1 | cds | g2422.t1.CDS4 | 17887554 | 17887561 |
| chr_3 | g2422 | g2422.t1 | TSS | g2422.t1 | NA | NA |
| chr_3 | g2422 | g2422.t1 | TTS | g2422.t1 | NA | NA |
Sequences
>g2422.t1 Gene=g2422 Length=447
ATGAAAGAATATTTCTTTGCTGCTGTTTTTCAATTTCAACTTCACCGTGCTATGTGTATT
GCTGCCGGCGAATTTGATCCAATAAATCCTTCGAAGCCGCTACATAAATGCAGCATTTAT
CGACATCATGAAGCTGGCGATATTCTAAAGAAAATCATGTCAAGAGGCGCGTCACAATCT
TGGCAACAAATACTGCAAGAGGTTTTAGGCGAAGGCCGTTTAGATGGATCAGCGGTGCGC
GAATATTTCCGCCCTCTTGAGGAATGGTTGCGTAATGAAAATTTGCGCAATCAAGAATTT
TTAGGATGGACGTATGATGGCGACTATTGCAAGAAAAGTATTGAAACAGCAAATCTTCAA
GTCTTTGGTGGCTTTTACAATGCAGCGTCGTATGCTTCGATTAGCACCAAGGTTCTCATT
TCGGCTTTGCTGTTACTTCTACTCTAA
>g2422.t1 Gene=g2422 Length=148
MKEYFFAAVFQFQLHRAMCIAAGEFDPINPSKPLHKCSIYRHHEAGDILKKIMSRGASQS
WQQILQEVLGEGRLDGSAVREYFRPLEEWLRNENLRNQEFLGWTYDGDYCKKSIETANLQ
VFGGFYNAASYASISTKVLISALLLLLL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g2422.t1 | PANTHER | PTHR10514 | ANGIOTENSIN-CONVERTING ENZYME | 3 | 146 | 4.3E-65 |
| 3 | g2422.t1 | PANTHER | PTHR10514:SF40 | ANGIOTENSIN-CONVERTING ENZYME | 3 | 146 | 4.3E-65 |
| 1 | g2422.t1 | Pfam | PF01401 | Angiotensin-converting enzyme | 3 | 103 | 9.5E-24 |
| 6 | g2422.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 19 | - |
| 7 | g2422.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 3 | - |
| 8 | g2422.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 4 | 14 | - |
| 9 | g2422.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 15 | 19 | - |
| 5 | g2422.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 20 | 148 | - |
| 4 | g2422.t1 | SUPERFAMILY | SSF55486 | Metalloproteases (zincins), catalytic domain | 3 | 114 | 1.47E-30 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016020 | membrane | CC |
| GO:0008241 | peptidyl-dipeptidase activity | MF |
| GO:0008237 | metallopeptidase activity | MF |
| GO:0006508 | proteolysis | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed