| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2515 | g2515.t25 | TSS | g2515.t25 | 18402860 | 18402860 |
| chr_3 | g2515 | g2515.t25 | isoform | g2515.t25 | 18403133 | 18404911 |
| chr_3 | g2515 | g2515.t25 | exon | g2515.t25.exon1 | 18403133 | 18403301 |
| chr_3 | g2515 | g2515.t25 | exon | g2515.t25.exon2 | 18403515 | 18403546 |
| chr_3 | g2515 | g2515.t25 | cds | g2515.t25.CDS1 | 18403538 | 18403546 |
| chr_3 | g2515 | g2515.t25 | exon | g2515.t25.exon3 | 18404522 | 18404911 |
| chr_3 | g2515 | g2515.t25 | cds | g2515.t25.CDS2 | 18404522 | 18404911 |
| chr_3 | g2515 | g2515.t25 | TTS | g2515.t25 | 18405229 | 18405229 |
>g2515.t25 Gene=g2515 Length=591
TTTCAATGTGATTAAATTTTATGCAATATAAGTACAATTTACGAAAAAAAATATCAGGAA
ATGATTCATAATGATTTTTTTCACCTTGTGTCTCTCTATTTTTAGGAATTACAAGATTTG
GGTAGAGATCCACCAGCGCAATGCTCAGCAGGTCCTGTTGGAGATGACCTTTTTCATTGG
CAAGCAACAATTATGGGACCTCCAGACAGTCCGTATCAGGGAGGCGTTTTCTTCTTAACA
ATACATTTCCCAACAGATTATCCATTCAAACCACCCAAAGTGGCTTTTACAACTCGCATA
TATCACCCAAACATCAATAGTAATGGGTCGATCTGTCTCGACATTTTAAGATCTCAATGG
TCACCTGCACTAACGATTTCAAAAGGTAAGTTGACATCATCTTGTTTAAATTTATTTTAT
TTCATTATTTTTTCATTATTCTCAATTCTAGTGTTGTTATCAATTTGCTCTCTTCTCTGT
GATCCTAATCCGGATGATCCACTAGTACCAGAAATCGCTAGAATATATAAAACGGATCGC
GAAAAATATAATGAACTGGCCCGTGAGTGGACTCGAAAGTATGCTATGTGA
>g2515.t25 Gene=g2515 Length=132
MGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPAL
TISKGKLTSSCLNLFYFIIFSLFSILVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYN
ELAREWTRKYAM
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 12 | g2515.t25 | CDD | cd00195 | UBCc | 1 | 127 | 1.54872E-52 |
| 8 | g2515.t25 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 1 | 132 | 9.9E-54 |
| 4 | g2515.t25 | PANTHER | PTHR24068:SF48 | UBIQUITIN-CONJUGATING ENZYME E2 D3 | 1 | 69 | 5.0E-65 |
| 6 | g2515.t25 | PANTHER | PTHR24068 | UBIQUITIN-CONJUGATING ENZYME E2 | 1 | 69 | 5.0E-65 |
| 3 | g2515.t25 | PANTHER | PTHR24068:SF48 | UBIQUITIN-CONJUGATING ENZYME E2 D3 | 70 | 132 | 5.0E-65 |
| 5 | g2515.t25 | PANTHER | PTHR24068 | UBIQUITIN-CONJUGATING ENZYME E2 | 70 | 132 | 5.0E-65 |
| 2 | g2515.t25 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 1 | 64 | 1.2E-28 |
| 1 | g2515.t25 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 87 | 126 | 1.5E-7 |
| 9 | g2515.t25 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 73 | - |
| 11 | g2515.t25 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 74 | 96 | - |
| 10 | g2515.t25 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 97 | 132 | - |
| 14 | g2515.t25 | ProSitePatterns | PS00183 | Ubiquitin-conjugating enzymes active site. | 37 | 52 | - |
| 16 | g2515.t25 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 1 | 121 | 35.918 |
| 15 | g2515.t25 | SMART | SM00212 | ubc_7 | 1 | 132 | 3.2E-35 |
| 7 | g2515.t25 | SUPERFAMILY | SSF54495 | UBC-like | 2 | 132 | 5.76E-44 |
| 13 | g2515.t25 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 74 | 96 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.