| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2515 | g2515.t7 | TSS | g2515.t7 | 18401902 | 18401902 |
| chr_3 | g2515 | g2515.t7 | isoform | g2515.t7 | 18402013 | 18405234 |
| chr_3 | g2515 | g2515.t7 | exon | g2515.t7.exon1 | 18402013 | 18402053 |
| chr_3 | g2515 | g2515.t7 | cds | g2515.t7.CDS1 | 18402013 | 18402053 |
| chr_3 | g2515 | g2515.t7 | exon | g2515.t7.exon2 | 18403258 | 18403301 |
| chr_3 | g2515 | g2515.t7 | cds | g2515.t7.CDS2 | 18403258 | 18403301 |
| chr_3 | g2515 | g2515.t7 | exon | g2515.t7.exon3 | 18404577 | 18404705 |
| chr_3 | g2515 | g2515.t7 | cds | g2515.t7.CDS3 | 18404577 | 18404705 |
| chr_3 | g2515 | g2515.t7 | exon | g2515.t7.exon4 | 18404772 | 18405234 |
| chr_3 | g2515 | g2515.t7 | cds | g2515.t7.CDS4 | 18404772 | 18404911 |
| chr_3 | g2515 | g2515.t7 | TTS | g2515.t7 | 18405229 | 18405229 |
>g2515.t7 Gene=g2515 Length=677
ATGGCTTTAAAAAGAATAAATAAGGTAGATAGCGTAGAAATAGATCCACCAGCGCAATGC
TCAGCAGGTCCTGTTGGAGATGACCATTATCCATTCAAACCACCCAAAGTGGCTTTTACA
ACTCGCATATATCACCCAAACATCAATAGTAATGGGTCGATCTGTCTCGACATTTTAAGA
TCTCAATGGTCACCTGCACTAACGATTTCAAAAGTGTTGTTATCAATTTGCTCTCTTCTC
TGTGATCCTAATCCGGATGATCCACTAGTACCAGAAATCGCTAGAATATATAAAACGGAT
CGCGAAAAATATAATGAACTGGCCCGTGAGTGGACTCGAAAGTATGCTATGTGATGCGTT
CCAGATGAGAAATTGTACCGTCAAAATTTAATTCTTGCTGTATTATAAACAAAAAACACA
CAGGCTCCACCAAAACAGCGCATCCTTTGATTTTTCTGTTCGTTGCTTCAAAACAATTTT
TTAATTTCAATTTTCATCTTTTGTCTATCTCATCTCTGTCGCCAGTCTTATTAAGAAGGA
TTGTAAAGAATATTGATGATAATAACCTTTTTTGTAAAAAAACAAAAAATCAGTTTAGTG
CGAAAGTGGGAAAAGCTTCACCTCTATATGATATATTTGAAGAAGAACTAAGAGAAATAA
AACTAAAAAAAAATGCA
>g2515.t7 Gene=g2515 Length=117
MALKRINKVDSVEIDPPAQCSAGPVGDDHYPFKPPKVAFTTRIYHPNINSNGSICLDILR
SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYAM
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g2515.t7 | CDD | cd00195 | UBCc | 4 | 112 | 9.67246E-45 |
| 7 | g2515.t7 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 27 | 117 | 6.1E-45 |
| 2 | g2515.t7 | PANTHER | PTHR24068:SF48 | UBIQUITIN-CONJUGATING ENZYME E2 D3 | 5 | 29 | 3.6E-59 |
| 4 | g2515.t7 | PANTHER | PTHR24068 | UBIQUITIN-CONJUGATING ENZYME E2 | 5 | 29 | 3.6E-59 |
| 3 | g2515.t7 | PANTHER | PTHR24068:SF48 | UBIQUITIN-CONJUGATING ENZYME E2 D3 | 29 | 117 | 3.6E-59 |
| 5 | g2515.t7 | PANTHER | PTHR24068 | UBIQUITIN-CONJUGATING ENZYME E2 | 29 | 117 | 3.6E-59 |
| 1 | g2515.t7 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 28 | 111 | 8.8E-34 |
| 9 | g2515.t7 | ProSitePatterns | PS00183 | Ubiquitin-conjugating enzymes active site. | 44 | 59 | - |
| 11 | g2515.t7 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 28 | 106 | 30.77 |
| 10 | g2515.t7 | SMART | SM00212 | ubc_7 | 3 | 117 | 2.2E-35 |
| 6 | g2515.t7 | SUPERFAMILY | SSF54495 | UBC-like | 19 | 117 | 3.81E-41 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.