Gene loci information

Transcript annotation

  • This transcript has been annotated as Calcitonin gene-related peptide type 1 receptor.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g2556 g2556.t1 TTS g2556.t1 18662497 18662497
chr_3 g2556 g2556.t1 isoform g2556.t1 18663390 18669677
chr_3 g2556 g2556.t1 exon g2556.t1.exon1 18663390 18663766
chr_3 g2556 g2556.t1 cds g2556.t1.CDS1 18663390 18663766
chr_3 g2556 g2556.t1 exon g2556.t1.exon2 18663830 18663903
chr_3 g2556 g2556.t1 cds g2556.t1.CDS2 18663830 18663903
chr_3 g2556 g2556.t1 exon g2556.t1.exon3 18665015 18665362
chr_3 g2556 g2556.t1 cds g2556.t1.CDS3 18665015 18665362
chr_3 g2556 g2556.t1 exon g2556.t1.exon4 18665430 18665521
chr_3 g2556 g2556.t1 cds g2556.t1.CDS4 18665430 18665521
chr_3 g2556 g2556.t1 exon g2556.t1.exon5 18665592 18665782
chr_3 g2556 g2556.t1 cds g2556.t1.CDS5 18665592 18665782
chr_3 g2556 g2556.t1 exon g2556.t1.exon6 18665846 18665890
chr_3 g2556 g2556.t1 cds g2556.t1.CDS6 18665846 18665890
chr_3 g2556 g2556.t1 exon g2556.t1.exon7 18665951 18666052
chr_3 g2556 g2556.t1 cds g2556.t1.CDS7 18665951 18666052
chr_3 g2556 g2556.t1 exon g2556.t1.exon8 18669671 18669677
chr_3 g2556 g2556.t1 cds g2556.t1.CDS8 18669671 18669677
chr_3 g2556 g2556.t1 TSS g2556.t1 18669810 18669810

Sequences

>g2556.t1 Gene=g2556 Length=1236
ATGGAAGATAACATAACGAGCAGCACACCGGAAGGTGGAATTTTATTGATAAAGAAACTG
TACAAACAATGCTTGCAATTAGCCTGGCAGTTAAATAACAGTAGTGCTGTAAATAACACA
GATTCGCCACCACAATGTCCAGTAATATTTGATGGTTTCACTTGTTGGGGGCCAACAAAA
ATTAATACAACTGATTATAAACCATGTCCATCATATGTAATTGGATTCAATGGAAATTCA
AATGCTTCAAAAGTCTGCTTAGAAAATGGATCATGGTATACAAATCCAAATACAGGACAA
CATTGGACAAATTATTTAGCTTGTGTTGACCATGAGGACTATACTTTCCGACAAACAATT
AACGATATTTATTTCTACGGTTATTGCGTTTCACTCTCAACACTCATAATTTCATTAGTC
ATATTTCTCAGCTTTAGATCATTAAAATGTACAAGAATTAAAATACATGTGCAATTATTC
ATCTCTTTGGCAATGAGTTGCATTTTATGGATAATCTGGTATAAATTTATCATTATTGAT
CCAAACATCGTGAAGGAAAATTCTTTAGGATGCATTGGCTTGCATATTGTACTGCAATAT
TTGATGATATGCAATTATTTCTGGATGTTCTGTGAGGGACTTCATTTGCATCTTGTGTTG
GTTGTTGTCTTTATAAAAGATAATGTTGCCATGCGAATATTCTTCATTATTGGATGGCTT
TTGCCTTTACTTATCATCACTGCATACAGCTTAATGAGGATGTATAATACAGTTGATAAT
AACTTATGTTGGATCGAGGAGAGTCATTATCAATATATTCTCACAATTCCTGTCTTAATC
TCCTTCATTTGCTCAATTATCTTCTTAGTGAACATAGTTCGAGTTCTAATTACAAAACTA
CATCCGAAATCAGAAGCACCGCCACCATTAGCAATAAAAAAGGCAGTTCGTGCGACATTA
ATTCTCATTCCATTGTTTGGATTACAGCATGTTCTCATTCCATTCAGACCAGAAAAAGGA
TCATCATTTGAAAGTATTTATCAAATTGTGTCTGCCGTTTTTGTAAGCCTTCAAGGACTT
TGTGTGTCATGTCTATTCTGCTTCGCTAATCACGAAGTTATTTCTGCCGTGTTTAGCTAT
TTGAGTAGTATATTTCCCATGATTTTCAAGACATCTTCGCGTGAAAATTATAACAATCTA
GGACAACCAACGACGACGAGAGATATTGTATTATAA

>g2556.t1 Gene=g2556 Length=411
MEDNITSSTPEGGILLIKKLYKQCLQLAWQLNNSSAVNNTDSPPQCPVIFDGFTCWGPTK
INTTDYKPCPSYVIGFNGNSNASKVCLENGSWYTNPNTGQHWTNYLACVDHEDYTFRQTI
NDIYFYGYCVSLSTLIISLVIFLSFRSLKCTRIKIHVQLFISLAMSCILWIIWYKFIIID
PNIVKENSLGCIGLHIVLQYLMICNYFWMFCEGLHLHLVLVVVFIKDNVAMRIFFIIGWL
LPLLIITAYSLMRMYNTVDNNLCWIEESHYQYILTIPVLISFICSIIFLVNIVRVLITKL
HPKSEAPPPLAIKKAVRATLILIPLFGLQHVLIPFRPEKGSSFESIYQIVSAVFVSLQGL
CVSCLFCFANHEVISAVFSYLSSIFPMIFKTSSRENYNNLGQPTTTRDIVL

Protein features from InterProScan

Transcript Database ID Name Start End E.value
32 g2556.t1 CDD cd15260 7tmB1_NPR_B4_insect-like 117 382 1.05333E-130
14 g2556.t1 Gene3D G3DSA:4.10.1240.10 Hormone receptor superfamily 11 110 4.5E-23
13 g2556.t1 Gene3D G3DSA:1.20.1070.10 - 111 395 3.6E-66
3 g2556.t1 PANTHER PTHR45620 PDF RECEPTOR-LIKE PROTEIN-RELATED 35 400 6.4E-123
4 g2556.t1 PANTHER PTHR45620:SF31 HECTOR, ISOFORM A 35 400 6.4E-123
7 g2556.t1 PRINTS PR00249 Secretin-like GPCR superfamily signature 122 146 2.8E-46
5 g2556.t1 PRINTS PR00249 Secretin-like GPCR superfamily signature 154 178 2.8E-46
11 g2556.t1 PRINTS PR00249 Secretin-like GPCR superfamily signature 193 216 2.8E-46
6 g2556.t1 PRINTS PR00249 Secretin-like GPCR superfamily signature 231 256 2.8E-46
8 g2556.t1 PRINTS PR00249 Secretin-like GPCR superfamily signature 272 297 2.8E-46
10 g2556.t1 PRINTS PR00249 Secretin-like GPCR superfamily signature 315 335 2.8E-46
9 g2556.t1 PRINTS PR00249 Secretin-like GPCR superfamily signature 348 369 2.8E-46
1 g2556.t1 Pfam PF02793 Hormone receptor domain 44 110 1.2E-12
2 g2556.t1 Pfam PF00002 7 transmembrane receptor (Secretin family) 122 362 8.8E-55
22 g2556.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 1 122 -
27 g2556.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 123 145 -
15 g2556.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 146 156 -
26 g2556.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 157 177 -
19 g2556.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 178 196 -
28 g2556.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 197 225 -
17 g2556.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 226 231 -
30 g2556.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 232 252 -
20 g2556.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 253 271 -
29 g2556.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 272 294 -
16 g2556.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 295 314 -
31 g2556.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 315 333 -
23 g2556.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 334 344 -
25 g2556.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 345 366 -
18 g2556.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 367 372 -
24 g2556.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 373 389 -
21 g2556.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 390 411 -
40 g2556.t1 ProSitePatterns PS00649 G-protein coupled receptors family 2 signature 1. 46 70 -
42 g2556.t1 ProSiteProfiles PS50227 G-protein coupled receptors family 2 profile 1. 23 112 17.458
41 g2556.t1 ProSiteProfiles PS50261 G-protein coupled receptors family 2 profile 2. 120 370 34.903
39 g2556.t1 SMART SM00008 HormR_1 42 117 2.0E-10
12 g2556.t1 SUPERFAMILY SSF111418 Hormone receptor domain 17 115 6.15E-22
33 g2556.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 123 145 -
38 g2556.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 155 174 -
37 g2556.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 187 209 -
34 g2556.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 229 251 -
36 g2556.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 272 294 -
35 g2556.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 346 368 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0016020 membrane CC
GO:0007186 G protein-coupled receptor signaling pathway BP
GO:0016021 integral component of membrane CC
GO:0004888 transmembrane signaling receptor activity MF
GO:0007166 cell surface receptor signaling pathway BP
GO:0004930 G protein-coupled receptor activity MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed