| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2608 | g2608.t14 | TSS | g2608.t14 | 19031543 | 19031543 |
| chr_3 | g2608 | g2608.t14 | isoform | g2608.t14 | 19031621 | 19032276 |
| chr_3 | g2608 | g2608.t14 | exon | g2608.t14.exon1 | 19031621 | 19031634 |
| chr_3 | g2608 | g2608.t14 | cds | g2608.t14.CDS1 | 19031621 | 19031634 |
| chr_3 | g2608 | g2608.t14 | exon | g2608.t14.exon2 | 19031732 | 19031798 |
| chr_3 | g2608 | g2608.t14 | cds | g2608.t14.CDS2 | 19031732 | 19031798 |
| chr_3 | g2608 | g2608.t14 | exon | g2608.t14.exon3 | 19032052 | 19032276 |
| chr_3 | g2608 | g2608.t14 | cds | g2608.t14.CDS3 | 19032052 | 19032276 |
| chr_3 | g2608 | g2608.t14 | TTS | g2608.t14 | 19032355 | 19032355 |
>g2608.t14 Gene=g2608 Length=306
ATGTCAGATACTGAAGAAGCCGCAGCTCCAGTTGCTGTCTCATTGGATGGCGCTATGGAC
TTAAATACTGCTCTTCAGGAACCTCAATACAAACAACTCATTACTGCTTTGTGCAACGAG
CATCAAATCCCATTGATTCGTGTCGATAGCAGCAAAAAATTAGGTGAATGGTCAGGTCTT
TGCAAGATCGACAAAGAGGGCAAACCAAGAAAGATTTGCGGATGTTCCTGTGTCGTTATT
AAAAACTTTGGTCAAGAAACACCAGCTTTGGACATTGTCAAGCAGCACTTGCGTTCATCA
GCTTAA
>g2608.t14 Gene=g2608 Length=101
MSDTEEAAAPVAVSLDGAMDLNTALQEPQYKQLITALCNEHQIPLIRVDSSKKLGEWSGL
CKIDKEGKPRKICGCSCVVIKNFGQETPALDIVKQHLRSSA
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g2608.t14 | Gene3D | G3DSA:3.30.1330.30 | - | 17 | 100 | 0 |
| 2 | g2608.t14 | PANTHER | PTHR11843 | 40S RIBOSOMAL PROTEIN S12 | 21 | 100 | 0 |
| 4 | g2608.t14 | PRINTS | PR00972 | Ribosomal protein S12E family signature | 45 | 66 | 0 |
| 3 | g2608.t14 | PRINTS | PR00972 | Ribosomal protein S12E family signature | 70 | 83 | 0 |
| 1 | g2608.t14 | Pfam | PF01248 | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family | 25 | 79 | 0 |
| 5 | g2608.t14 | SUPERFAMILY | SSF55315 | L30e-like | 26 | 97 | 0 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed