Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative 40S ribosomal protein S12.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g2608 g2608.t14 TSS g2608.t14 19031543 19031543
chr_3 g2608 g2608.t14 isoform g2608.t14 19031621 19032276
chr_3 g2608 g2608.t14 exon g2608.t14.exon1 19031621 19031634
chr_3 g2608 g2608.t14 cds g2608.t14.CDS1 19031621 19031634
chr_3 g2608 g2608.t14 exon g2608.t14.exon2 19031732 19031798
chr_3 g2608 g2608.t14 cds g2608.t14.CDS2 19031732 19031798
chr_3 g2608 g2608.t14 exon g2608.t14.exon3 19032052 19032276
chr_3 g2608 g2608.t14 cds g2608.t14.CDS3 19032052 19032276
chr_3 g2608 g2608.t14 TTS g2608.t14 19032355 19032355

Sequences

>g2608.t14 Gene=g2608 Length=306
ATGTCAGATACTGAAGAAGCCGCAGCTCCAGTTGCTGTCTCATTGGATGGCGCTATGGAC
TTAAATACTGCTCTTCAGGAACCTCAATACAAACAACTCATTACTGCTTTGTGCAACGAG
CATCAAATCCCATTGATTCGTGTCGATAGCAGCAAAAAATTAGGTGAATGGTCAGGTCTT
TGCAAGATCGACAAAGAGGGCAAACCAAGAAAGATTTGCGGATGTTCCTGTGTCGTTATT
AAAAACTTTGGTCAAGAAACACCAGCTTTGGACATTGTCAAGCAGCACTTGCGTTCATCA
GCTTAA

>g2608.t14 Gene=g2608 Length=101
MSDTEEAAAPVAVSLDGAMDLNTALQEPQYKQLITALCNEHQIPLIRVDSSKKLGEWSGL
CKIDKEGKPRKICGCSCVVIKNFGQETPALDIVKQHLRSSA

Protein features from InterProScan

Transcript Database ID Name Start End E.value
6 g2608.t14 Gene3D G3DSA:3.30.1330.30 - 17 100 0
2 g2608.t14 PANTHER PTHR11843 40S RIBOSOMAL PROTEIN S12 21 100 0
4 g2608.t14 PRINTS PR00972 Ribosomal protein S12E family signature 45 66 0
3 g2608.t14 PRINTS PR00972 Ribosomal protein S12E family signature 70 83 0
1 g2608.t14 Pfam PF01248 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family 25 79 0
5 g2608.t14 SUPERFAMILY SSF55315 L30e-like 26 97 0

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0005840 ribosome CC
GO:0006412 translation BP
GO:0003735 structural constituent of ribosome MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed